Changes between Initial Version and Version 1 of Ticket #20389


Ignore:
Timestamp:
May 26, 2026, 10:00:05 AM (2 days ago)
Author:
Eric Pettersen
Comment:

Legend:

Unmodified
Added
Removed
Modified
  • Ticket #20389

    • Property Component UnassignedSequence
    • Property Owner set to Zach Pearson
    • Property Platformall
    • Property ProjectChimeraX
    • Property Status newassigned
    • Property Summary ChimeraX bug report submissionParsing BlastProtein results failed: HTTP Error 415: Unsupported Media Type
  • Ticket #20389 – Description

    initial v1  
    15091509Alignment of 6cm4 chain A to query has RMSD 1.02 using 55 of 126 paired
    15101510residues within cutoff distance 2.0 
    1511 Fetching compressed mmCIF 3g3x from http://files.rcsb.org/download/3g3x.cif 
    1512 3g3x title: 
    1513 Crystal structure of spin labeled T4 Lysozyme (T151R1) at 100 K [more info...] 
    1514  
    1515 Chain information for 3g3x #46 
    1516 --- 
    1517 Chain | Description | UniProt 
    1518 A | Lysozyme | LYS_BPT4 1-164 
    1519  
    1520 Non-standard residues in 3g3x #46 
    1521 --- 
    1522 AZI — azide ion 
    1523 CL — chloride ion 
    1524 HED — 2-hydroxyethyl disulfide 
    1525 MTN — S-[(1-oxyl-2,2,5,5-tetramethyl-2,5-dihydro-1H-pyrrol-3-yl)methyl]
    1526 methanesulfonothioate (MTSL) 
    1527  
    1528 26 atoms have alternate locations. Control/examine alternate locations with
    1529 Altloc Explorer [start tool...] or the altlocs command. 
    1530 Deleted 9 C-terminal residues, 2 N-terminal residues, 66 non-polymer residues
    1531 more than 3.0 Angstroms away. 
    1532 Alignment of 3g3x chain A to query has RMSD 0.973 using 49 of 126 paired
    1533 residues within cutoff distance 2.0 
    1534 1zyt title: 
    1535 Crystal structure of spin labeled T4 Lysozyme (A82R1) [more info...] 
    1536  
    1537 Chain information for 1zyt #47 
    1538 --- 
    1539 Chain | Description | UniProt 
    1540 A | Lysozyme | LYS_BPT4 1-164 
    1541  
    1542 Non-standard residues in 1zyt #47 
    1543 --- 
    1544 AZI — azide ion 
    1545 CL — chloride ion 
    1546 HED — 2-hydroxyethyl disulfide 
    1547 MTN — S-[(1-oxyl-2,2,5,5-tetramethyl-2,5-dihydro-1H-pyrrol-3-yl)methyl]
    1548 methanesulfonothioate (MTSL) 
    1549  
    1550 17 atoms have alternate locations. Control/examine alternate locations with
    1551 Altloc Explorer [start tool...] or the altlocs command. 
    1552 Deleted 11 C-terminal residues, 2 N-terminal residues, 104 non-polymer
    1553 residues more than 3.0 Angstroms away. 
    1554 Alignment of 1zyt chain A to query has RMSD 0.98 using 50 of 124 paired
    1555 residues within cutoff distance 2.0 
    1556 Fetching compressed mmCIF 3sb8 from http://files.rcsb.org/download/3sb8.cif 
    1557 3sb8 title: 
    1558 Cu-mediated Dimer of T4 Lysozyme D61H/K65H by Synthetic Symmetrization [more
    1559 info...] 
    1560  
    1561 Chain information for 3sb8 #48 
    1562 --- 
    1563 Chain | Description | UniProt 
    1564 A B C | Lysozyme | LYS_BPT4 1-162 
    1565  
    1566 Non-standard residues in 3sb8 #48 
    1567 --- 
    1568 CU — copper (II) ion 
    1569  
    1570 3sb8 mmCIF Assemblies 
    1571 --- 
    1572 1| author_and_software_defined_assembly 
    1573 2| author_and_software_defined_assembly 
    1574  
    1575 Deleted 2 extra chains, 9 C-terminal residues, 5 N-terminal residues, 9 non-
    1576 polymer residues more than 3.0 Angstroms away. 
    1577 Alignment of 3sb8 chain A to query has RMSD 0.981 using 49 of 127 paired
    1578 residues within cutoff distance 2.0 
    1579 238l title: 
    1580 The response of T4 lysozyme to large-to-small substitutions within the core
    1581 and its relation to the hydrophobic effect [more info...] 
    1582  
    1583 Chain information for 238l #49 
    1584 --- 
    1585 Chain | Description | UniProt 
    1586 A | T4 LYSOZYME | LYS_BPT4 1-164 
    1587  
    1588 Non-standard residues in 238l #49 
    1589 --- 
    1590 CL — chloride ion 
    1591 HED — 2-hydroxyethyl disulfide 
    1592  
    1593 Deleted 9 C-terminal residues, 2 N-terminal residues, 70 non-polymer residues
    1594 more than 3.0 Angstroms away. 
    1595 Alignment of 238l chain A to query has RMSD 0.934 using 46 of 125 paired
    1596 residues within cutoff distance 2.0 
    1597 Fetching compressed mmCIF 1p46 from http://files.rcsb.org/download/1p46.cif 
    1598 1p46 title: 
    1599 T4 lysozyme core repacking mutant M106I/TA [more info...] 
    1600  
    1601 Chain information for 1p46 #50 
    1602 --- 
    1603 Chain | Description | UniProt 
    1604 A | LYSOZYME | LYS_BPT4 1-164 
    1605  
    1606 Non-standard residues in 1p46 #50 
    1607 --- 
    1608 CL — chloride ion 
    1609 HED — 2-hydroxyethyl disulfide 
    1610 K — potassium ion 
    1611  
    1612 24 atoms have alternate locations. Control/examine alternate locations with
    1613 Altloc Explorer [start tool...] or the altlocs command. 
    1614 Deleted 11 C-terminal residues, 2 N-terminal residues, 116 non-polymer
    1615 residues more than 3.0 Angstroms away. 
    1616 Alignment of 1p46 chain A to query has RMSD 0.99 using 52 of 125 paired
    1617 residues within cutoff distance 2.0 
    1618 1l65 title: 
    1619 Tolerance of T4 lysozyme to multiple xaa (right arrow) ala substitutions: A
    1620 polyalanine α-helix containing ten consecutive alanines [more info...] 
    1621  
    1622 Chain information for 1l65 #51 
    1623 --- 
    1624 Chain | Description | UniProt 
    1625 A | LYSOZYME | LYCV_BPT4 1-164 
    1626  
    1627 Non-standard residues in 1l65 #51 
    1628 --- 
    1629 BME — β-mercaptoethanol 
    1630 CL — chloride ion 
    1631  
    1632 Deleted 9 C-terminal residues, 2 N-terminal residues, 53 non-polymer residues
    1633 more than 3.0 Angstroms away. 
    1634 Alignment of 1l65 chain A to query has RMSD 1.01 using 49 of 124 paired
    1635 residues within cutoff distance 2.0 
    1636 1g0k title: 
    1637 Crystal structure of T4 lysozyme mutant T152C [more info...] 
    1638  
    1639 Chain information for 1g0k #52 
    1640 --- 
    1641 Chain | Description | UniProt 
    1642 A | PROTEIN (LYSOZYME) | LYS_BPT4 1-164 
    1643  
    1644 Non-standard residues in 1g0k #52 
    1645 --- 
    1646 CL — chloride ion 
    1647 HED — 2-hydroxyethyl disulfide 
    1648  
    1649 Deleted 11 C-terminal residues, 2 N-terminal residues, 74 non-polymer residues
    1650 more than 3.0 Angstroms away. 
    1651 Alignment of 1g0k chain A to query has RMSD 0.999 using 49 of 125 paired
    1652 residues within cutoff distance 2.0 
    1653 8gtm title: 
    1654 Corticotropin-releasing hormone receptor 1(CRF1R) bound with BMK-C203 by XFEL
    1655 [more info...] 
    1656  
    1657 Chain information for 8gtm #53 
    1658 --- 
    1659 Chain | Description | UniProt 
    1660 A | Isoform CRF-R2 of Corticotropin-releasing factor receptor 1 | CRFR1_HUMAN 104-373 
    1661 B | Endolysin | A0A346FJK3_BPT6 1000-1159 
    1662  
    1663 Non-standard residues in 8gtm #53 
    1664 --- 
    1665 0VI — 7-(4-bromanyl-2,6-dimethoxy-
    1666 phenyl)-4,8-dimethyl-~{N},~{N}-bis[4,4,4-tris(fluoranyl)butyl]-1$l^{4},3,5,9-tetrazabicyclo[4.3.0]nona-1(6),2,4,8-tetraen-2-amine 
    1667  
    1668 Deleted 1 extra chains, 8 C-terminal residues, 1 N-terminal residues, 1 non-
    1669 polymer residues more than 3.0 Angstroms away. 
    1670 Alignment of 8gtm chain B to query has RMSD 1.28 using 69 of 126 paired
    1671 residues within cutoff distance 2.0 
    1672 3sba title: 
    1673 Zn-mediated Hexamer of T4 Lysozyme R76H/R80H by Synthetic Symmetrization [more
    1674 info...] 
    1675  
    1676 Chain information for 3sba #54 
    1677 --- 
    1678 Chain | Description | UniProt 
    1679 A B C D E F | Lysozyme | LYS_BPT4 1-162 
    1680  
    1681 Non-standard residues in 3sba #54 
    1682 --- 
    1683 CL — chloride ion 
    1684 ZN — zinc ion 
    1685  
    1686 7770 atoms have anisotropic B-factors. Depict anisotropic information with
    1687 Thermal Ellipsoids [start tool...] or the aniso command. 
    1688 Deleted 5 extra chains, 9 C-terminal residues, 3 N-terminal residues, 6 non-
    1689 polymer residues more than 3.0 Angstroms away. 
    1690 Alignment of 3sba chain E to query has RMSD 1.35 using 57 of 127 paired
    1691 residues within cutoff distance 2.0 
    1692 3c8r title: 
    1693 Contributions of all 20 amino acids at site 96 to stability and structure of
    1694 T4 lysozyme [more info...] 
    1695  
    1696 Chain information for 3c8r #55 
    1697 --- 
    1698 Chain | Description | UniProt 
    1699 A | Lysozyme | LYS_BPT4 1-164 
    1700  
    1701 Non-standard residues in 3c8r #55 
    1702 --- 
    1703 BME — β-mercaptoethanol 
    1704 CL — chloride ion 
    1705  
    1706 13 atoms have alternate locations. Control/examine alternate locations with
    1707 Altloc Explorer [start tool...] or the altlocs command. 
    1708 Deleted 11 C-terminal residues, 2 N-terminal residues, 22 non-polymer residues
    1709 more than 3.0 Angstroms away. 
    1710 Alignment of 3c8r chain A to query has RMSD 1 using 48 of 125 paired residues
    1711 within cutoff distance 2.0 
    1712 2ntg title: 
    1713 Structure of Spin-labeled T4 Lysozyme Mutant T115R7 [more info...] 
    1714  
    1715 Chain information for 2ntg #56 
    1716 --- 
    1717 Chain | Description | UniProt 
    1718 A | Lysozyme | LYS_BPT4 1-164 
    1719  
    1720 Non-standard residues in 2ntg #56 
    1721 --- 
    1722 BME — β-mercaptoethanol 
    1723 R7A —
    1724 S-[(4-bromo-1-oxyl-2,2,5,5-tetramethyl-2,5-dihydro-1H-pyrrol-3-yl)methyl]
    1725 methanesulfonothioate 
    1726  
    1727 253 atoms have anisotropic B-factors. Depict anisotropic information with
    1728 Thermal Ellipsoids [start tool...] or the aniso command. 
    1729 Deleted 11 C-terminal residues, 2 N-terminal residues, 122 non-polymer
    1730 residues more than 3.0 Angstroms away. 
    1731 Alignment of 2ntg chain A to query has RMSD 0.999 using 50 of 124 paired
    1732 residues within cutoff distance 2.0 
    1733 1g06 title: 
    1734 Crystal structure of T4 lysozyme mutant V149S [more info...] 
    1735  
    1736 Chain information for 1g06 #57 
    1737 --- 
    1738 Chain | Description | UniProt 
    1739 A | PROTEIN (LYSOZYME) | LYS_BPT4 1-164 
    1740  
    1741 Non-standard residues in 1g06 #57 
    1742 --- 
    1743 CL — chloride ion 
    1744 HED — 2-hydroxyethyl disulfide 
    1745  
    1746 Deleted 11 C-terminal residues, 2 N-terminal residues, 72 non-polymer residues
    1747 more than 3.0 Angstroms away. 
    1748 Alignment of 1g06 chain A to query has RMSD 0.994 using 48 of 125 paired
    1749 residues within cutoff distance 2.0 
    1750 Fetching compressed mmCIF 177l from http://files.rcsb.org/download/177l.cif 
    1751 177l title: 
    1752 Protein flexibility and adaptability seen in 25 crystal forms of T4 LYSOZYME
    1753 [more info...] 
    1754  
    1755 Chain information for 177l #58 
    1756 --- 
    1757 Chain | Description | UniProt 
    1758 A | T4 LYSOZYME | LYS_BPT4 1-164 
    1759  
    1760 Deleted 9 C-terminal residues, 2 N-terminal residues, 3 non-polymer residues
    1761 more than 3.0 Angstroms away. 
    1762 Alignment of 177l chain A to query has RMSD 0.986 using 46 of 125 paired
    1763 residues within cutoff distance 2.0 
    1764 122l title: 
    1765 The energetic cost and the structural consequences of burying A hydroxyl group
    1766 within the core of A protein determined from ala to ser and val to THR
    1767 substitutions In T4 lysozyme [more info...] 
    1768  
    1769 Chain information for 122l #59 
    1770 --- 
    1771 Chain | Description | UniProt 
    1772 A | T4 LYSOZYME | LYCV_BPT4 1-164 
    1773  
    1774 Non-standard residues in 122l #59 
    1775 --- 
    1776 BME — β-mercaptoethanol 
    1777 CL — chloride ion 
    1778  
    1779 Deleted 9 C-terminal residues, 2 N-terminal residues, 67 non-polymer residues
    1780 more than 3.0 Angstroms away. 
    1781 Alignment of 122l chain A to query has RMSD 1.03 using 50 of 125 paired
    1782 residues within cutoff distance 2.0 
    1783 Fetching compressed mmCIF 103l from http://files.rcsb.org/download/103l.cif 
    1784 103l title: 
    1785 How amino-acid insertions are allowed In an α-helix of T4 lysozyme [more
    1786 info...] 
    1787  
    1788 Chain information for 103l #60 
    1789 --- 
    1790 Chain | Description | UniProt 
    1791 A | T4 LYSOZYME | LYS_BPT4 1-164 
    1792  
    1793 Non-standard residues in 103l #60 
    1794 --- 
    1795 BME — β-mercaptoethanol 
    1796 CL — chloride ion 
    1797  
    1798 Deleted 9 C-terminal residues, 2 N-terminal residues, 76 non-polymer residues
    1799 more than 3.0 Angstroms away. 
    1800 Alignment of 103l chain A to query has RMSD 0.898 using 45 of 124 paired
    1801 residues within cutoff distance 2.0 
    1802 Fetching compressed mmCIF 5kio from http://files.rcsb.org/download/5kio.cif 
    1803 5kio title: 
    1804 Pseudo T4 lysozyme mutant - Y18PHE-I [more info...] 
    1805  
    1806 Chain information for 5kio #61 
    1807 --- 
    1808 Chain | Description | UniProt 
    1809 A | Endolysin | ENLYS_BPT4 1-164 
    1810  
    1811 Non-standard residues in 5kio #61 
    1812 --- 
    1813 HED — 2-hydroxyethyl disulfide 
    1814  
    1815 75 atoms have alternate locations. Control/examine alternate locations with
    1816 Altloc Explorer [start tool...] or the altlocs command. 
    1817 Deleted 9 C-terminal residues, 2 N-terminal residues, 133 non-polymer residues
    1818 more than 3.0 Angstroms away. 
    1819 Alignment of 5kio chain A to query has RMSD 0.971 using 48 of 126 paired
    1820 residues within cutoff distance 2.0 
    1821 3pbl title: 
    1822 Structure of the human dopamine D3 receptor in complex with eticlopride [more
    1823 info...] 
    1824  
    1825 Chain information for 3pbl #62 
    1826 --- 
    1827 Chain | Description | UniProt 
    1828 A B | D(3) dopamine receptor, Lysozyme chimera | DRD3_HUMAN 2-221 319-400, LYS_BPT4 1002-1161 
    1829  
    1830 Non-standard residues in 3pbl #62 
    1831 --- 
    1832 ETQ —
    1833 3-chloro-5-ethyl-N-{[(2S)-1-ethylpyrrolidin-2-yl]methyl}-6-hydroxy-2-methoxybenzamide 
    1834 GLC — alpha-D-glucopyranose (alpha-D-glucose; D-glucose; glucose) 
    1835  
    1836 3pbl mmCIF Assemblies 
    1837 --- 
    1838 1| software_defined_assembly 
    1839 2| software_defined_assembly 
    1840  
    1841 6695 atoms have anisotropic B-factors. Depict anisotropic information with
    1842 Thermal Ellipsoids [start tool...] or the aniso command. 
    1843 Deleted 1 extra chains, 90 C-terminal residues, 191 N-terminal residues, 4
    1844 non-polymer residues more than 3.0 Angstroms away. 
    1845 Alignment of 3pbl chain A to query has RMSD 0.95 using 47 of 127 paired
    1846 residues within cutoff distance 2.0 
    1847 1p2l title: 
    1848 T4 Lysozyme Core Repacking Mutant V87I/TA [more info...] 
    1849  
    1850 Chain information for 1p2l #63 
    1851 --- 
    1852 Chain | Description | UniProt 
    1853 A | LYSOZYME | LYS_BPT4 1-164 
    1854  
    1855 Non-standard residues in 1p2l #63 
    1856 --- 
    1857 CL — chloride ion 
    1858 HED — 2-hydroxyethyl disulfide 
    1859 K — potassium ion 
    1860 PO4 — phosphate ion 
    1861  
    1862 41 atoms have alternate locations. Control/examine alternate locations with
    1863 Altloc Explorer [start tool...] or the altlocs command. 
    1864 Deleted 11 C-terminal residues, 2 N-terminal residues, 114 non-polymer
    1865 residues more than 3.0 Angstroms away. 
    1866 Alignment of 1p2l chain A to query has RMSD 0.943 using 48 of 124 paired
    1867 residues within cutoff distance 2.0 
    1868 Fetching compressed mmCIF 1l82 from http://files.rcsb.org/download/1l82.cif 
    1869 1l82 title: 
    1870 Design and structural analysis of alternative hydrophobic core packing
    1871 arrangements In bacteriophage T4 lysozyme [more info...] 
    1872  
    1873 Chain information for 1l82 #64 
    1874 --- 
    1875 Chain | Description | UniProt 
    1876 A | T4 LYSOZYME | LYCV_BPT4 1-164 
    1877  
    1878 Non-standard residues in 1l82 #64 
    1879 --- 
    1880 BME — β-mercaptoethanol 
    1881 CL — chloride ion 
    1882  
    1883 Deleted 9 C-terminal residues, 2 N-terminal residues, 62 non-polymer residues
    1884 more than 3.0 Angstroms away. 
    1885 Alignment of 1l82 chain A to query has RMSD 1.01 using 48 of 124 paired
    1886 residues within cutoff distance 2.0 
    1887 1l36 title: 
    1888 Toward A simplification of the protein folding problem: A stabilizing
    1889 polyalanine α-helix engineered In T4 lysozyme [more info...] 
    1890  
    1891 Chain information for 1l36 #65 
    1892 --- 
    1893 Chain | Description | UniProt 
    1894 A | LYSOZYME | LYS_BPT4 1-164 
    1895  
    1896 Non-standard residues in 1l36 #65 
    1897 --- 
    1898 BME — β-mercaptoethanol 
    1899 CL — chloride ion 
    1900  
    1901 Deleted 9 C-terminal residues, 2 N-terminal residues, 71 non-polymer residues
    1902 more than 3.0 Angstroms away. 
    1903 Alignment of 1l36 chain A to query has RMSD 1.02 using 47 of 125 paired
    1904 residues within cutoff distance 2.0 
    1905 162l title: 
    1906 Control of enzyme activity by an engineered disulfide bond [more info...] 
    1907  
    1908 Chain information for 162l #66 
    1909 --- 
    1910 Chain | Description | UniProt 
    1911 A | T4 LYSOZYME | LYCV_BPT4 1-164 
    1912  
    1913 Non-standard residues in 162l #66 
    1914 --- 
    1915 BME — β-mercaptoethanol 
    1916 CL — chloride ion 
    1917  
    1918 Deleted 9 C-terminal residues, 2 N-terminal residues, 63 non-polymer residues
    1919 more than 3.0 Angstroms away. 
    1920 Alignment of 162l chain A to query has RMSD 0.995 using 48 of 125 paired
    1921 residues within cutoff distance 2.0 
    1922 3pbl title: 
    1923 Structure of the human dopamine D3 receptor in complex with eticlopride [more
    1924 info...] 
    1925  
    1926 Chain information for 3pbl #67 
    1927 --- 
    1928 Chain | Description | UniProt 
    1929 A B | D(3) dopamine receptor, Lysozyme chimera | DRD3_HUMAN 2-221 319-400, LYS_BPT4 1002-1161 
    1930  
    1931 Non-standard residues in 3pbl #67 
    1932 --- 
    1933 ETQ —
    1934 3-chloro-5-ethyl-N-{[(2S)-1-ethylpyrrolidin-2-yl]methyl}-6-hydroxy-2-methoxybenzamide 
    1935 GLC — alpha-D-glucopyranose (alpha-D-glucose; D-glucose; glucose) 
    1936  
    1937 3pbl mmCIF Assemblies 
    1938 --- 
    1939 1| software_defined_assembly 
    1940 2| software_defined_assembly 
    1941  
    1942 6695 atoms have anisotropic B-factors. Depict anisotropic information with
    1943 Thermal Ellipsoids [start tool...] or the aniso command. 
    1944 Deleted 1 extra chains, 90 C-terminal residues, 167 N-terminal residues, 5
    1945 non-polymer residues more than 3.0 Angstroms away. 
    1946 Alignment of 3pbl chain B to query has RMSD 1 using 46 of 142 paired residues
    1947 within cutoff distance 2.0 
    1948 232l title: 
    1949 T4 lysozyme mutant M120K [more info...] 
    1950  
    1951 Chain information for 232l #68 
    1952 --- 
    1953 Chain | Description | UniProt 
    1954 A | T4 LYSOZYME | LYS_BPT4 1-164 
    1955  
    1956 Non-standard residues in 232l #68 
    1957 --- 
    1958 BME — β-mercaptoethanol 
    1959 CL — chloride ion 
    1960  
    1961 Deleted 9 C-terminal residues, 2 N-terminal residues, 56 non-polymer residues
    1962 more than 3.0 Angstroms away. 
    1963 Alignment of 232l chain A to query has RMSD 0.973 using 48 of 125 paired
    1964 residues within cutoff distance 2.0 
    1965 1tla title: 
    1966 Hydrophobic core repacking and aromatic-aromatic interaction In the
    1967 thermostable mutant of T4 lysozyme ser 117 (right arrow) phe [more info...] 
    1968  
    1969 Chain information for 1tla #69 
    1970 --- 
    1971 Chain | Description | UniProt 
    1972 A | T4 LYSOZYME | LYS_BPT4 1-164 
    1973  
    1974 Non-standard residues in 1tla #69 
    1975 --- 
    1976 CL — chloride ion 
    1977 PO4 — phosphate ion 
    1978  
    1979 Deleted 9 C-terminal residues, 2 N-terminal residues, 59 non-polymer residues
    1980 more than 3.0 Angstroms away. 
    1981 Alignment of 1tla chain A to query has RMSD 1.04 using 50 of 125 paired
    1982 residues within cutoff distance 2.0 
    1983 1g0g title: 
    1984 Crystal structure of T4 lysozyme mutant T152A [more info...] 
    1985  
    1986 Chain information for 1g0g #70 
    1987 --- 
    1988 Chain | Description | UniProt 
    1989 A | PROTEIN (LYSOZYME) | LYS_BPT4 1-164 
    1990  
    1991 Non-standard residues in 1g0g #70 
    1992 --- 
    1993 CL — chloride ion 
    1994 HED — 2-hydroxyethyl disulfide 
    1995  
    1996 Deleted 9 C-terminal residues, 2 N-terminal residues, 75 non-polymer residues
    1997 more than 3.0 Angstroms away. 
    1998 Alignment of 1g0g chain A to query has RMSD 0.987 using 49 of 125 paired
    1999 residues within cutoff distance 2.0 
    2000 172l title: 
    2001 Protein flexibility and adaptability seen In 25 crystal forms of T4 lysozyme
    2002 [more info...] 
    2003  
    2004 Chain information for 172l #71 
    2005 --- 
    2006 Chain | Description | UniProt 
    2007 A | T4 LYSOZYME | LYS_BPT4 1-164 
    2008  
    2009 Non-standard residues in 172l #71 
    2010 --- 
    2011 BME — β-mercaptoethanol 
    2012  
    2013 Deleted 11 C-terminal residues, 2 N-terminal residues, 20 non-polymer residues
    2014 more than 3.0 Angstroms away. 
    2015 Alignment of 172l chain A to query has RMSD 1.26 using 69 of 124 paired
    2016 residues within cutoff distance 2.0 
    2017 Fetching compressed mmCIF 5w0p from http://files.rcsb.org/download/5w0p.cif 
    2018 5w0p title: 
    2019 Crystal structure of rhodopsin bound to visual arrestin determined by X-ray
    2020 free electron laser [more info...] 
    2021  
    2022 Chain information for 5w0p #72 
    2023 --- 
    2024 Chain | Description | UniProt 
    2025 A B C D | Endolysin,Rhodopsin,S-arrestin | A0A097J792_BPT4 -159-0, OPSD_HUMAN 1-1994, ARRS_MOUSE 2010-2392 
    2026  
    2027 Non-standard residues in 5w0p #72 
    2028 --- 
    2029 NAG — 2-acetamido-2-deoxy-beta-D-glucopyranose (N-acetyl-beta-D-glucosamine;
    2030 2-acetamido-2-deoxy-beta-D-glucose; 2-acetamido-2-deoxy-D-glucose;
    2031 2-acetamido-2-deoxy-glucose; N-ACETYL-D-GLUCOSAMINE) 
    2032  
    2033 5w0p mmCIF Assemblies 
    2034 --- 
    2035 1| author_defined_assembly 
    2036 2| author_defined_assembly 
    2037 3| author_defined_assembly 
    2038 4| author_defined_assembly 
    2039  
    2040 25976 atoms have anisotropic B-factors. Depict anisotropic information with
    2041 Thermal Ellipsoids [start tool...] or the aniso command. 
    2042 Deleted 3 extra chains, 698 C-terminal residues, 8 non-polymer residues more
    2043 than 3.0 Angstroms away. 
    2044 Alignment of 5w0p chain C to query has RMSD 1.33 using 53 of 126 paired
    2045 residues within cutoff distance 2.0 
    2046 1l72 title: 
    2047 Multiple stabilizing alanine replacements within α-helix 126-134 of T4
    2048 lysozyme have independent, additive effects on both structure and stability
    2049 [more info...] 
    2050  
    2051 Chain information for 1l72 #73 
    2052 --- 
    2053 Chain | Description | UniProt 
    2054 A | LYSOZYME | LYS_BPT4 1-164 
    2055  
    2056 Non-standard residues in 1l72 #73 
    2057 --- 
    2058 BME — β-mercaptoethanol 
    2059 CL — chloride ion 
    2060  
    2061 Deleted 9 C-terminal residues, 2 N-terminal residues, 64 non-polymer residues
    2062 more than 3.0 Angstroms away. 
    2063 Alignment of 1l72 chain A to query has RMSD 0.89 using 44 of 125 paired
    2064 residues within cutoff distance 2.0 
    2065 1i6s title: 
    2066 T4 lysozyme mutant C54T/C97A/N101A [more info...] 
    2067  
    2068 Chain information for 1i6s #74 
    2069 --- 
    2070 Chain | Description | UniProt 
    2071 A | LYSOZYME | LYS_BPT4 1-164 
    2072  
    2073 Non-standard residues in 1i6s #74 
    2074 --- 
    2075 CL — chloride ion 
    2076 HED — 2-hydroxyethyl disulfide 
    2077  
    2078 Deleted 9 C-terminal residues, 2 N-terminal residues, 57 non-polymer residues
    2079 more than 3.0 Angstroms away. 
    2080 Alignment of 1i6s chain A to query has RMSD 1.04 using 50 of 125 paired
    2081 residues within cutoff distance 2.0 
    2082 1g0p title: 
    2083 Crystal structure of T4 lysozyme mutant V149G [more info...] 
    2084  
    2085 Chain information for 1g0p #75 
    2086 --- 
    2087 Chain | Description | UniProt 
    2088 A | PROTEIN (LYSOZYME) | LYS_BPT4 1-164 
    2089  
    2090 Non-standard residues in 1g0p #75 
    2091 --- 
    2092 CL — chloride ion 
    2093 HED — 2-hydroxyethyl disulfide 
    2094  
    2095 Deleted 11 C-terminal residues, 2 N-terminal residues, 75 non-polymer residues
    2096 more than 3.0 Angstroms away. 
    2097 Alignment of 1g0p chain A to query has RMSD 1.02 using 48 of 125 paired
    2098 residues within cutoff distance 2.0 
    2099 Fetching compressed mmCIF 167l from http://files.rcsb.org/download/167l.cif 
    2100 167l title: 
    2101 Protein flexibility and adaptability seen In 25 crystal forms of T4 lysozyme
    2102 [more info...] 
    2103  
    2104 Chain information for 167l #76 
    2105 --- 
    2106 Chain | Description | UniProt 
    2107 A B | T4 LYSOZYME | LYS_BPT4 1-163 
    2108  
    2109 167l mmCIF Assemblies 
    2110 --- 
    2111 1| author_defined_assembly 
    2112 2| author_defined_assembly 
    2113  
    2114 Deleted 1 extra chains, 11 C-terminal residues, 2 N-terminal residues, 28 non-
    2115 polymer residues more than 3.0 Angstroms away. 
    2116 Alignment of 167l chain A to query has RMSD 1.02 using 48 of 125 paired
    2117 residues within cutoff distance 2.0 
    2118 146l title: 
    2119 Role of backbone flexibility In the accommodation of variants that repack the
    2120 core of T4 lysozyme [more info...] 
    2121  
    2122 Chain information for 146l #77 
    2123 --- 
    2124 Chain | Description | UniProt 
    2125 A | T4 LYSOZYME | LYCV_BPT4 1-164 
    2126  
    2127 Non-standard residues in 146l #77 
    2128 --- 
    2129 BME — β-mercaptoethanol 
    2130 CL — chloride ion 
    2131  
    2132 Deleted 9 C-terminal residues, 2 N-terminal residues, 41 non-polymer residues
    2133 more than 3.0 Angstroms away. 
    2134 Alignment of 146l chain A to query has RMSD 0.981 using 47 of 127 paired
    2135 residues within cutoff distance 2.0 
    2136 5kii title: 
    2137 Pseudo T4 lysozyme mutant - Y88PHE-methyl [more info...] 
    2138  
    2139 Chain information for 5kii #78 
    2140 --- 
    2141 Chain | Description | UniProt 
    2142 A | Endolysin | ENLYS_BPT4 1-164 
    2143  
    2144 Non-standard residues in 5kii #78 
    2145 --- 
    2146 HED — 2-hydroxyethyl disulfide 
    2147 PO4 — phosphate ion 
    2148  
    2149 101 atoms have alternate locations. Control/examine alternate locations with
    2150 Altloc Explorer [start tool...] or the altlocs command. 
    2151 
    2152 Hit structure sequence 5kii_A amino acid F at sequence position 87 does not
    2153 match sequence alignment D at position 85. Structure sequence
    2154 MNIFEMLRIDEGLRLKIYKDTEGYYTIGIGHLLTKSPSLNAAKSELDKAIGRNTNGVITKDEAEKLFNQDVDAAVRGILRNAKLKPVFDSLDAVRRAALINMVFQMGETGVAGFTNSLRMLQQKRWDEAAVNLAKSRWYNQTPNRAKRVITTFRTGTWDAYKNLHHHHHH.
    2155 Alignment sequence
    2156 IFEMLRIDEGLRLKIYKDTEGYYTIGIGHLLTKSPSLNAAKSELDKAIGRNTNGVITKDEAEKLFNQDVDAAVRGILRNAKLKPVDSLDAVRRAALINMVFQMGETGVAGFTNSLRMLQQKRWDEAAVNLAKSRWYNQTPNRAKRVITTF. 
    2157 
    2158 Deleted 10 C-terminal residues, 2 N-terminal residues, 186 non-polymer
    2159 residues more than 3.0 Angstroms away. 
    2160 Alignment of 5kii chain A to query has RMSD 1.21 using 25 of 124 paired
    2161 residues within cutoff distance 2.0 
    2162 Fetching compressed mmCIF 4yc4 from http://files.rcsb.org/download/4yc4.cif 
    2163 Fetching CCD M59 from
    2164 https://files.wwpdb.org/pub/pdb/refdata/chem_comp/9/M59/M59.cif 
    2165 4yc4 title: 
    2166 Crystal structure of phosphatidyl inositol 4-kinase II α in complex with
    2167 nucleotide analog [more info...] 
    2168  
    2169 Chain information for 4yc4 #79 
    2170 --- 
    2171 Chain | Description | UniProt 
    2172 A | Phosphatidylinositol 4-kinase type 2-alpha,Lysozyme,Phosphatidylinositol 4-kinase type 2-alpha | P4K2A_HUMAN 76-172 180-468, D9IEF7_BPT4 1004-1166 
    2173  
    2174 Non-standard residues in 4yc4 #79 
    2175 --- 
    2176 ADP — adenosine-5'-diphosphate 
    2177 M59 — [(1S,3S,4S)-3-(6-amino-9H-purin-9-yl)bicyclo[2.2.1]hept-1-yl]methanol 
    2178  
    2179 Deleted 259 C-terminal residues, 73 N-terminal residues, 5 non-polymer
    2180 residues more than 3.0 Angstroms away. 
    2181 Alignment of 4yc4 chain A to query has RMSD 0.805 using 43 of 129 paired
    2182 residues within cutoff distance 2.0 
    2183 3l64 title: 
    2184 T4 Lysozyme S44E/WT* [more info...] 
    2185  
    2186 Chain information for 3l64 #80 
    2187 --- 
    2188 Chain | Description | UniProt 
    2189 A | Lysozyme | LYS_BPT4 1-164 
    2190  
    2191 Non-standard residues in 3l64 #80 
    2192 --- 
    2193 BME — β-mercaptoethanol 
    2194  
    2195 Deleted 11 C-terminal residues, 2 N-terminal residues, 37 non-polymer residues
    2196 more than 3.0 Angstroms away. 
    2197 Alignment of 3l64 chain A to query has RMSD 0.93 using 45 of 127 paired
    2198 residues within cutoff distance 2.0 
    2199 237l title: 
    2200 The response of T4 lysozyme to large-to-small substitutions within the core
    2201 and its relation to the hydrophobic effect [more info...] 
    2202  
    2203 Chain information for 237l #81 
    2204 --- 
    2205 Chain | Description | UniProt 
    2206 A | T4 LYSOZYME | LYS_BPT4 1-164 
    2207  
    2208 Non-standard residues in 237l #81 
    2209 --- 
    2210 CL — chloride ion 
    2211 HED — 2-hydroxyethyl disulfide 
    2212  
    2213 Deleted 11 C-terminal residues, 2 N-terminal residues, 81 non-polymer residues
    2214 more than 3.0 Angstroms away. 
    2215 Alignment of 237l chain A to query has RMSD 1.02 using 49 of 125 paired
    2216 residues within cutoff distance 2.0 
    2217 1l67 title: 
    2218 Tolerance of T4 lysozyme to multiple xaa (right arrow) ala substitutions: A
    2219 polyalanine α-helix containing ten consecutive alanines [more info...] 
    2220  
    2221 Chain information for 1l67 #82 
    2222 --- 
    2223 Chain | Description | UniProt 
    2224 A | LYSOZYME | LYCV_BPT4 1-164 
    2225  
    2226 Non-standard residues in 1l67 #82 
    2227 --- 
    2228 BME — β-mercaptoethanol 
    2229 CL — chloride ion 
    2230  
    2231 Deleted 7 C-terminal residues, 2 N-terminal residues, 55 non-polymer residues
    2232 more than 3.0 Angstroms away. 
    2233 Alignment of 1l67 chain A to query has RMSD 0.972 using 48 of 127 paired
    2234 residues within cutoff distance 2.0 
    2235 1l53 title: 
    2236 Structural and thermodynamic analysis of the packing of two α-helices In
    2237 bacteriophage T4 lysozyme [more info...] 
    2238  
    2239 Chain information for 1l53 #83 
    2240 --- 
    2241 Chain | Description | UniProt 
    2242 A | T4 LYSOZYME | LYS_BPT4 1-164 
    2243  
    2244 Non-standard residues in 1l53 #83 
    2245 --- 
    2246 BME — β-mercaptoethanol 
    2247  
    2248 Deleted 11 C-terminal residues, 2 N-terminal residues, 72 non-polymer residues
    2249 more than 3.0 Angstroms away. 
    2250 Alignment of 1l53 chain A to query has RMSD 0.877 using 44 of 125 paired
    2251 residues within cutoff distance 2.0 
    2252 1l40 title: 
    2253 Contributions of engineered surface salt bridges to the stability of T4
    2254 lysozyme determined by directed mutagenesis [more info...] 
    2255  
    2256 Chain information for 1l40 #84 
    2257 --- 
    2258 Chain | Description | UniProt 
    2259 A | T4 LYSOZYME | LYS_BPT4 1-164 
    2260  
    2261 Deleted 11 C-terminal residues, 2 N-terminal residues, 69 non-polymer residues
    2262 more than 3.0 Angstroms away. 
    2263 Alignment of 1l40 chain A to query has RMSD 0.936 using 46 of 125 paired
    2264 residues within cutoff distance 2.0 
    2265 1l18 title: 
    2266 Hydrophobic stabilization In T4 lysozyme determined directly by multiple
    2267 substitutions of ile 3 [more info...] 
    2268  
    2269 Chain information for 1l18 #85 
    2270 --- 
    2271 Chain | Description | UniProt 
    2272 A | T4 LYSOZYME | LYS_BPT4 1-164 
    2273  
    2274 Deleted 11 C-terminal residues, 2 N-terminal residues, 65 non-polymer residues
    2275 more than 3.0 Angstroms away. 
    2276 Alignment of 1l18 chain A to query has RMSD 1.02 using 49 of 125 paired
    2277 residues within cutoff distance 2.0 
    2278 155l title: 
    2279 Control of enzyme activity by an engineered disulfide bond [more info...] 
    2280  
    2281 Chain information for 155l #86 
    2282 --- 
    2283 Chain | Description | UniProt 
    2284 A | T4 LYSOZYME | LYCV_BPT4 1-164 
    2285  
    2286 Non-standard residues in 155l #86 
    2287 --- 
    2288 BME — β-mercaptoethanol 
    2289 CL — chloride ion 
    2290  
    2291 Deleted 9 C-terminal residues, 2 N-terminal residues, 55 non-polymer residues
    2292 more than 3.0 Angstroms away. 
    2293 Alignment of 155l chain A to query has RMSD 1.01 using 48 of 125 paired
    2294 residues within cutoff distance 2.0 
    2295 Fetching compressed mmCIF 152l from http://files.rcsb.org/download/152l.cif 
    2296 152l title: 
    2297 Conservation of solvent-binding sites In 10 crystal forms of T4 lysozyme [more
    2298 info...] 
    2299  
    2300 Chain information for 152l #87 
    2301 --- 
    2302 Chain | Description | UniProt 
    2303 A | T4 LYSOZYME | LYS_BPT4 1-163 
    2304  
    2305 Non-standard residues in 152l #87 
    2306 --- 
    2307 SO4 — sulfate ion 
    2308  
    2309 Deleted 11 C-terminal residues, 2 N-terminal residues, 22 non-polymer residues
    2310 more than 3.0 Angstroms away. 
    2311 Alignment of 152l chain A to query has RMSD 0.866 using 42 of 127 paired
    2312 residues within cutoff distance 2.0 
    2313 
    2314 Atom D1 is not in the residue template for MET /A:1 
    2315 
    2316 Atom D is not in the residue template for ASN /A:2 
    2317 
    2318 Atom D is not in the residue template for ILE /A:3 
    2319 
    2320 Atom D is not in the residue template for PHE /A:4 
    2321 
    2322 Atom D is not in the residue template for GLU /A:5 
    2323 
    2324 Atom D is not in the residue template for ALA /A:6 
    2325 
    2326 Atom D is not in the residue template for LEU /A:7 
    2327 
    2328 Atom D is not in the residue template for ARG /A:8 
    2329 
    2330 Atom D is not in the residue template for ILE /A:9 
    2331 
    2332 Too many hydrogens missing from residue template(s) to warn about 
    2333 
    2334 6u0e title: 
    2335 Neutron crystal structure of T4L M6AE [more info...] 
    2336  
    2337 Chain information for 6u0e #88 
    2338 --- 
    2339 Chain | Description | UniProt 
    2340 A | Endolysin | D9IEF7_BPT4 1-164 
    2341  
    2342 664 atoms have alternate locations. Control/examine alternate locations with
    2343 Altloc Explorer [start tool...] or the altlocs command. 
    2344 Deleted 11 C-terminal residues, 2 N-terminal residues. 
    2345 Alignment of 6u0e chain A to query has RMSD 1.03 using 48 of 126 paired
    2346 residues within cutoff distance 2.0 
    2347 Fetching compressed mmCIF 6u0c from http://files.rcsb.org/download/6u0c.cif 
    2348 
    2349 Atom D1 is not in the residue template for MET /A:1 
    2350 
    2351 Atom D is not in the residue template for ASN /A:2 
    2352 
    2353 Atom D is not in the residue template for ILE /A:3 
    2354 
    2355 Atom D is not in the residue template for PHE /A:4 
    2356 
    2357 Atom D is not in the residue template for GLU /A:5 
    2358 
    2359 Atom D is not in the residue template for MET /A:6 
    2360 
    2361 Atom D is not in the residue template for LEU /A:7 
    2362 
    2363 Atom D is not in the residue template for ARG /A:8 
    2364 
    2365 Atom D is not in the residue template for ILE /A:9 
    2366 
    2367 Too many hydrogens missing from residue template(s) to warn about 
    2368 
    2369 6u0c title: 
    2370 Neutron crystal structure of wtT4LE [more info...] 
    2371  
    2372 Chain information for 6u0c #89 
    2373 --- 
    2374 Chain | Description | UniProt 
    2375 A | Endolysin | D9IEF7_BPT4 1-164 
    2376  
    2377 Non-standard residues in 6u0c #89 
    2378 --- 
    2379 CL — chloride ion 
    2380  
    2381 656 atoms have alternate locations. Control/examine alternate locations with
    2382 Altloc Explorer [start tool...] or the altlocs command. 
    2383 Deleted 11 C-terminal residues, 2 N-terminal residues, 1 non-polymer residues
    2384 more than 3.0 Angstroms away. 
    2385 Alignment of 6u0c chain A to query has RMSD 0.988 using 48 of 126 paired
    2386 residues within cutoff distance 2.0 
    2387 Fetching compressed mmCIF 4djh from http://files.rcsb.org/download/4djh.cif 
    2388 Fetching CCD JDC from
    2389 https://files.wwpdb.org/pub/pdb/refdata/chem_comp/C/JDC/JDC.cif 
    2390 4djh title: 
    2391 Structure of the human κ opioid receptor in complex with JDTic [more info...] 
    2392  
    2393 Chain information for 4djh #90 
    2394 --- 
    2395 Chain | Description | UniProt 
    2396 A B | Kappa-type opioid receptor, Lysozyme | OPRK_HUMAN 43-261 263-358, LYS_BPT4 1002-1161 
    2397  
    2398 Non-standard residues in 4djh #90 
    2399 --- 
    2400 CIT — citric acid 
    2401 JDC —
    2402 (3R)-7-hydroxy-N-{(2S)-1-[(3R,4R)-4-(3-hydroxyphenyl)-3,4-dimethylpiperidin-1-yl]-3-methylbutan-2-yl}-1,2,3,4-tetrahydroisoquinoline-3-carboxamide 
    2403 OLC — (2R)-2,3-dihydroxypropyl (9Z)-octadec-9-enoate (1-Oleoyl-R-glycerol) 
    2404 PEG — di(hydroxyethyl)ether 
    2405  
    2406 4djh mmCIF Assemblies 
    2407 --- 
    2408 1| software_defined_assembly 
    2409 2| software_defined_assembly 
    2410  
    2411 6932 atoms have anisotropic B-factors. Depict anisotropic information with
    2412 Thermal Ellipsoids [start tool...] or the aniso command. 
    2413 Deleted 1 extra chains, 88 C-terminal residues, 192 N-terminal residues, 29
    2414 non-polymer residues more than 3.0 Angstroms away. 
    2415 Alignment of 4djh chain A to query has RMSD 1.34 using 54 of 141 paired
    2416 residues within cutoff distance 2.0 
    2417 Fetching compressed mmCIF 3fa0 from http://files.rcsb.org/download/3fa0.cif 
    2418 3fa0 title: 
    2419 Evaulaution at Atomic Resolution of the Role of Strain in Destabilizing the
    2420 Temperature Sensitive T4 Lysozyme Mutant Arg96-->His [more info...] 
    2421  
    2422 Chain information for 3fa0 #91 
    2423 --- 
    2424 Chain | Description | UniProt 
    2425 A | Lysozyme | LYS_BPT4 1-162 
    2426  
    2427 Non-standard residues in 3fa0 #91 
    2428 --- 
    2429 BME — β-mercaptoethanol 
    2430 CL — chloride ion 
    2431 HED — 2-hydroxyethyl disulfide 
    2432 K — potassium ion 
    2433 PO4 — phosphate ion 
    2434  
    2435 37 atoms have alternate locations. Control/examine alternate locations with
    2436 Altloc Explorer [start tool...] or the altlocs command. 
    2437 1528 atoms have anisotropic B-factors. Depict anisotropic information with
    2438 Thermal Ellipsoids [start tool...] or the aniso command. 
    2439 Deleted 9 C-terminal residues, 2 N-terminal residues, 103 non-polymer residues
    2440 more than 3.0 Angstroms away. 
    2441 Alignment of 3fa0 chain A to query has RMSD 0.991 using 50 of 125 paired
    2442 residues within cutoff distance 2.0 
    2443 2ray title: 
    2444 beta-chlorophenetole in complex with T4 lysozyme L99A [more info...] 
    2445  
    2446 Chain information for 2ray #92 
    2447 --- 
    2448 Chain | Description | UniProt 
    2449 X | Lysozyme | LYS_BPT4 1-162 
    2450  
    2451 Non-standard residues in 2ray #92 
    2452 --- 
    2453 258 — (2-chloroethoxy)benzene 
    2454 PO4 — phosphate ion 
    2455  
    2456 6 atoms have alternate locations. Control/examine alternate locations with
    2457 Altloc Explorer [start tool...] or the altlocs command. 
    2458 Deleted 9 C-terminal residues, 2 N-terminal residues, 93 non-polymer residues
    2459 more than 3.0 Angstroms away. 
    2460 Alignment of 2ray chain X to query has RMSD 0.931 using 48 of 124 paired
    2461 residues within cutoff distance 2.0 
    2462 260l title: 
    2463 AN adaptable metal-binding site engineered INTO T4 lysozyme [more info...] 
    2464  
    2465 Chain information for 260l #93 
    2466 --- 
    2467 Chain | Description | UniProt 
    2468 A | PROTEIN (LYSOZYME) | LYS_BPT4 1-164 
    2469  
    2470 Non-standard residues in 260l #93 
    2471 --- 
    2472 CL — chloride ion 
    2473 NI — nickel (II) ion 
    2474  
    2475 Deleted 9 C-terminal residues, 2 N-terminal residues, 58 non-polymer residues
    2476 more than 3.0 Angstroms away. 
    2477 Alignment of 260l chain A to query has RMSD 0.86 using 43 of 126 paired
    2478 residues within cutoff distance 2.0 
    2479 Fetching compressed mmCIF 1l86 from http://files.rcsb.org/download/1l86.cif 
    2480 1l86 title: 
    2481 Similar hydrophobic replacements of leu 99 and phe 153 within the core of T4
    2482 lysozyme have different structural and thermodynamic consequences [more
    2483 info...] 
    2484  
    2485 Chain information for 1l86 #94 
    2486 --- 
    2487 Chain | Description | UniProt 
    2488 A | T4 LYSOZYME | LYCV_BPT4 1-164 
    2489  
    2490 Non-standard residues in 1l86 #94 
    2491 --- 
    2492 BME — β-mercaptoethanol 
    2493 CL — chloride ion 
    2494  
    2495 Deleted 9 C-terminal residues, 2 N-terminal residues, 63 non-polymer residues
    2496 more than 3.0 Angstroms away. 
    2497 Alignment of 1l86 chain A to query has RMSD 0.866 using 46 of 125 paired
    2498 residues within cutoff distance 2.0 
    2499 Fetching compressed mmCIF 7z36 from http://files.rcsb.org/download/7z36.cif 
    2500 7z36 title: 
    2501 Crystal structure of the KAP1 tripartite motif in complex with the ZNF93 KRAB
    2502 domain [more info...] 
    2503  
    2504 Chain information for 7z36 #95 
    2505 --- 
    2506 Chain | Description | UniProt 
    2507 A B | Endolysin,Transcription intermediary factor 1-beta,Isoform 2 of Transcription intermediary factor 1-beta | ENLYS_BPT4 26-185, TIF1B_HUMAN 187-271, TIF1B-2_HUMAN 272-482 
    2508 C S | SMARCAD1 CUE1 domain |   
    2509 D | Zinc finger protein 93 | ZNF93_HUMAN 2-71 
    2510  
    2511 Non-standard residues in 7z36 #95 
    2512 --- 
    2513 ZN — zinc ion 
    2514  
    2515 7889 atoms have anisotropic B-factors. Depict anisotropic information with
    2516 Thermal Ellipsoids [start tool...] or the aniso command. 
    2517 Deleted 4 extra chains, 272 C-terminal residues, 8 non-polymer residues more
    2518 than 3.0 Angstroms away. 
    2519 Alignment of 7z36 chain A to query has RMSD 0.913 using 46 of 134 paired
    2520 residues within cutoff distance 2.0 
    2521 Fetching compressed mmCIF 6pgy from http://files.rcsb.org/download/6pgy.cif 
    2522 6pgy title: 
    2523 MTSL labelled T4 lysozyme pseudo-wild type K65C mutant [more info...] 
    2524  
    2525 Chain information for 6pgy #96 
    2526 --- 
    2527 Chain | Description | UniProt 
    2528 A | Endolysin | D9IEF7_BPT4 1-164 
    2529  
    2530 Non-standard residues in 6pgy #96 
    2531 --- 
    2532 CL — chloride ion 
    2533 HED — 2-hydroxyethyl disulfide 
    2534 MTN — S-[(1-oxyl-2,2,5,5-tetramethyl-2,5-dihydro-1H-pyrrol-3-yl)methyl]
    2535 methanesulfonothioate (MTSL) 
    2536  
    2537 41 atoms have alternate locations. Control/examine alternate locations with
    2538 Altloc Explorer [start tool...] or the altlocs command. 
    2539 Deleted 9 C-terminal residues, 2 N-terminal residues, 32 non-polymer residues
    2540 more than 3.0 Angstroms away. 
    2541 Alignment of 6pgy chain A to query has RMSD 0.98 using 47 of 126 paired
    2542 residues within cutoff distance 2.0 
    2543 254l title: 
    2544 Lysozyme [more info...] 
    2545  
    2546 Chain information for 254l #97 
    2547 --- 
    2548 Chain | Description | UniProt 
    2549 A | LYSOZYME | LYS_BPT4 1-164 
    2550  
    2551 Non-standard residues in 254l #97 
    2552 --- 
    2553 BME — β-mercaptoethanol 
    2554 CL — chloride ion 
    2555  
    2556 Deleted 11 C-terminal residues, 2 N-terminal residues, 84 non-polymer residues
    2557 more than 3.0 Angstroms away. 
    2558 Alignment of 254l chain A to query has RMSD 0.98 using 48 of 125 paired
    2559 residues within cutoff distance 2.0 
    2560 213l title: 
    2561 Protein structure plasticity exemplified by insertion and deletion mutants In
    2562 T4 lysozyme [more info...] 
    2563  
    2564 Chain information for 213l #98 
    2565 --- 
    2566 Chain | Description | UniProt 
    2567 A | T4 LYSOZYME | LYS_BPT4 1-164 
    2568  
    2569 Deleted 9 C-terminal residues, 2 N-terminal residues, 46 non-polymer residues
    2570 more than 3.0 Angstroms away. 
    2571 Alignment of 213l chain A to query has RMSD 0.987 using 48 of 125 paired
    2572 residues within cutoff distance 2.0 
    2573 1l88 title: 
    2574 Similar hydrophobic replacements of leu 99 and phe 153 within the core of T4
    2575 lysozyme have different structural and thermodynamic consequences [more
    2576 info...] 
    2577  
    2578 Chain information for 1l88 #99 
    2579 --- 
    2580 Chain | Description | UniProt 
    2581 A | T4 LYSOZYME | LYCV_BPT4 1-164 
    2582  
    2583 Non-standard residues in 1l88 #99 
    2584 --- 
    2585 BME — β-mercaptoethanol 
    2586 CL — chloride ion 
    2587  
    2588 Deleted 9 C-terminal residues, 2 N-terminal residues, 60 non-polymer residues
    2589 more than 3.0 Angstroms away. 
    2590 Alignment of 1l88 chain A to query has RMSD 1.07 using 50 of 125 paired
    2591 residues within cutoff distance 2.0 
    2592 114l title: 
    2593 Structural basis of α-helix propensity At two sites In T4 lysozyme [more
    2594 info...] 
    2595  
    2596 Chain information for 114l #100 
    2597 --- 
    2598 Chain | Description | UniProt 
    2599 A | T4 LYSOZYME | LYCV_BPT4 1-164 
    2600  
    2601 Non-standard residues in 114l #100 
    2602 --- 
    2603 BME — β-mercaptoethanol 
    2604 CL — chloride ion 
    2605  
    2606 Deleted 9 C-terminal residues, 2 N-terminal residues, 62 non-polymer residues
    2607 more than 3.0 Angstroms away. 
    2608 Alignment of 114l chain A to query has RMSD 1 using 48 of 125 paired residues
    2609 within cutoff distance 2.0 
    2610 102l title: 
    2611 How amino-acid insertions are allowed In an α-helix of T4 lysozyme [more
    2612 info...] 
    2613  
    2614 Chain information for 102l #101 
    2615 --- 
    2616 Chain | Description | UniProt 
    2617 A | T4 LYSOZYME | LYS_BPT4 1-164 
    2618  
    2619 Non-standard residues in 102l #101 
    2620 --- 
    2621 BME — β-mercaptoethanol 
    2622 CL — chloride ion 
    2623  
    2624 Deleted 9 C-terminal residues, 2 N-terminal residues, 62 non-polymer residues
    2625 more than 3.0 Angstroms away. 
    2626 Alignment of 102l chain A to query has RMSD 1 using 48 of 125 paired residues
    2627 within cutoff distance 2.0 
    2628 4djh title: 
    2629 Structure of the human κ opioid receptor in complex with JDTic [more info...] 
    2630  
    2631 Chain information for 4djh #102 
    2632 --- 
    2633 Chain | Description | UniProt 
    2634 A B | Kappa-type opioid receptor, Lysozyme | OPRK_HUMAN 43-261 263-358, LYS_BPT4 1002-1161 
    2635  
    2636 Non-standard residues in 4djh #102 
    2637 --- 
    2638 CIT — citric acid 
    2639 JDC —
    2640 (3R)-7-hydroxy-N-{(2S)-1-[(3R,4R)-4-(3-hydroxyphenyl)-3,4-dimethylpiperidin-1-yl]-3-methylbutan-2-yl}-1,2,3,4-tetrahydroisoquinoline-3-carboxamide 
    2641 OLC — (2R)-2,3-dihydroxypropyl (9Z)-octadec-9-enoate (1-Oleoyl-R-glycerol) 
    2642 PEG — di(hydroxyethyl)ether 
    2643  
    2644 4djh mmCIF Assemblies 
    2645 --- 
    2646 1| software_defined_assembly 
    2647 2| software_defined_assembly 
    2648  
    2649 6932 atoms have anisotropic B-factors. Depict anisotropic information with
    2650 Thermal Ellipsoids [start tool...] or the aniso command. 
    2651 Deleted 1 extra chains, 88 C-terminal residues, 199 N-terminal residues, 30
    2652 non-polymer residues more than 3.0 Angstroms away. 
    2653 Alignment of 4djh chain B to query has RMSD 0.918 using 47 of 134 paired
    2654 residues within cutoff distance 2.0 
    2655 3fad title: 
    2656 Evaulaution at Atomic Resolution of the Role of Strain in Destabilizing the
    2657 Temperature Sensitive T4 Lysozyme Mutant Arg96-->His [more info...] 
    2658  
    2659 Chain information for 3fad #103 
    2660 --- 
    2661 Chain | Description | UniProt 
    2662 A | Lysozyme | LYS_BPT4 1-164 
    2663  
    2664 Non-standard residues in 3fad #103 
    2665 --- 
    2666 BME — β-mercaptoethanol 
    2667 PO4 — phosphate ion 
    2668  
    2669 3fad mmCIF Assemblies 
    2670 --- 
    2671 1| author_defined_assembly 
    2672 2| software_defined_assembly 
    2673  
    2674 72 atoms have alternate locations. Control/examine alternate locations with
    2675 Altloc Explorer [start tool...] or the altlocs command. 
    2676 1525 atoms have anisotropic B-factors. Depict anisotropic information with
    2677 Thermal Ellipsoids [start tool...] or the aniso command. 
    2678 Deleted 11 C-terminal residues, 2 N-terminal residues, 103 non-polymer
    2679 residues more than 3.0 Angstroms away. 
    2680 Alignment of 3fad chain A to query has RMSD 0.971 using 46 of 122 paired
    2681 residues within cutoff distance 2.0 
    2682 1qt6 title: 
    2683 E11H Mutant of T4 Lysozyme [more info...] 
    2684  
    2685 Chain information for 1qt6 #104 
    2686 --- 
    2687 Chain | Description | UniProt 
    2688 A | PROTEIN (T4 LYSOZYME) | LYS_BPT4 1-164 
    2689  
    2690 Non-standard residues in 1qt6 #104 
    2691 --- 
    2692 BME — β-mercaptoethanol 
    2693 CL — chloride ion 
    2694  
    2695 Deleted 11 C-terminal residues, 2 N-terminal residues, 72 non-polymer residues
    2696 more than 3.0 Angstroms away. 
    2697 Alignment of 1qt6 chain A to query has RMSD 1.07 using 50 of 125 paired
    2698 residues within cutoff distance 2.0 
    2699 1qs9 title: 
    2700 The introduction of strain and its effects on the structure and stability of
    2701 T4 lysozyme [more info...] 
    2702  
    2703 Chain information for 1qs9 #105 
    2704 --- 
    2705 Chain | Description | UniProt 
    2706 A | LYSOZYME | LYS_BPT4 1-162 
    2707  
    2708 Deleted 9 C-terminal residues, 2 N-terminal residues, 58 non-polymer residues
    2709 more than 3.0 Angstroms away. 
    2710 Alignment of 1qs9 chain A to query has RMSD 1.06 using 49 of 125 paired
    2711 residues within cutoff distance 2.0 
    2712 1p36 title: 
    2713 T4 lyoszyme core repacking mutant I100V/Ta [more info...] 
    2714  
    2715 Chain information for 1p36 #106 
    2716 --- 
    2717 Chain | Description | UniProt 
    2718 A | LYSOZYME | LYS_BPT4 1-164 
    2719  
    2720 Non-standard residues in 1p36 #106 
    2721 --- 
    2722 BME — β-mercaptoethanol 
    2723 CL — chloride ion 
    2724 K — potassium ion 
    2725  
    2726 14 atoms have alternate locations. Control/examine alternate locations with
    2727 Altloc Explorer [start tool...] or the altlocs command. 
    2728 Deleted 11 C-terminal residues, 2 N-terminal residues, 104 non-polymer
    2729 residues more than 3.0 Angstroms away. 
    2730 Alignment of 1p36 chain A to query has RMSD 0.987 using 50 of 124 paired
    2731 residues within cutoff distance 2.0 
    2732 1l32 title: 
    2733 Replacements of PRO86 In phage T4 lysozyme extend an α-helix but do not alter
    2734 protein stability [more info...] 
    2735  
    2736 Chain information for 1l32 #107 
    2737 --- 
    2738 Chain | Description | UniProt 
    2739 A | T4 LYSOZYME | LYS_BPT4 1-164 
    2740  
    2741 Deleted 11 C-terminal residues, 2 N-terminal residues, 75 non-polymer residues
    2742 more than 3.0 Angstroms away. 
    2743 Alignment of 1l32 chain A to query has RMSD 1.02 using 48 of 127 paired
    2744 residues within cutoff distance 2.0 
    2745 5w0p title: 
    2746 Crystal structure of rhodopsin bound to visual arrestin determined by X-ray
    2747 free electron laser [more info...] 
    2748  
    2749 Chain information for 5w0p #108 
    2750 --- 
    2751 Chain | Description | UniProt 
    2752 A B C D | Endolysin,Rhodopsin,S-arrestin | A0A097J792_BPT4 -159-0, OPSD_HUMAN 1-1994, ARRS_MOUSE 2010-2392 
    2753  
    2754 Non-standard residues in 5w0p #108 
    2755 --- 
    2756 NAG — 2-acetamido-2-deoxy-beta-D-glucopyranose (N-acetyl-beta-D-glucosamine;
    2757 2-acetamido-2-deoxy-beta-D-glucose; 2-acetamido-2-deoxy-D-glucose;
    2758 2-acetamido-2-deoxy-glucose; N-ACETYL-D-GLUCOSAMINE) 
    2759  
    2760 5w0p mmCIF Assemblies 
    2761 --- 
    2762 1| author_defined_assembly 
    2763 2| author_defined_assembly 
    2764 3| author_defined_assembly 
    2765 4| author_defined_assembly 
    2766  
    2767 25976 atoms have anisotropic B-factors. Depict anisotropic information with
    2768 Thermal Ellipsoids [start tool...] or the aniso command. 
    2769 Deleted 3 extra chains, 697 C-terminal residues, 8 non-polymer residues more
    2770 than 3.0 Angstroms away. 
    2771 Alignment of 5w0p chain A to query has RMSD 0.939 using 41 of 126 paired
    2772 residues within cutoff distance 2.0 
    2773 3cdv title: 
    2774 Contributions of all 20 amino acids at site 96 to the stability and structure
    2775 of T4 lysozyme [more info...] 
    2776  
    2777 Chain information for 3cdv #109 
    2778 --- 
    2779 Chain | Description | UniProt 
    2780 A | Lysozyme | LYS_BPT4 1-164 
    2781  
    2782 Non-standard residues in 3cdv #109 
    2783 --- 
    2784 BME — β-mercaptoethanol 
    2785 CL — chloride ion 
    2786  
    2787 38 atoms have alternate locations. Control/examine alternate locations with
    2788 Altloc Explorer [start tool...] or the altlocs command. 
    2789 Deleted 11 C-terminal residues, 2 N-terminal residues, 38 non-polymer residues
    2790 more than 3.0 Angstroms away. 
    2791 Alignment of 3cdv chain A to query has RMSD 1 using 49 of 125 paired residues
    2792 within cutoff distance 2.0 
    2793 201l title: 
    2794 How amino-acid insertions are allowed In an α-helix of T4 lysozyme [more
    2795 info...] 
    2796  
    2797 Chain information for 201l #110 
    2798 --- 
    2799 Chain | Description | UniProt 
    2800 A B | T4 LYSOZYME | LYCV_BPT4 1-164 
    2801  
    2802 Non-standard residues in 201l #110 
    2803 --- 
    2804 BME — β-mercaptoethanol 
    2805  
    2806 201l mmCIF Assemblies 
    2807 --- 
    2808 1| author_defined_assembly 
    2809 2| author_defined_assembly 
    2810  
    2811 Deleted 1 extra chains, 9 C-terminal residues, 2 N-terminal residues, 94 non-
    2812 polymer residues more than 3.0 Angstroms away. 
    2813 Alignment of 201l chain A to query has RMSD 0.907 using 46 of 125 paired
    2814 residues within cutoff distance 2.0 
    2815 1c6n title: 
    2816 T4 lysozyme mutant C54T/C97A/L99A/F153A In the presence of 8 atm xenon [more
    2817 info...] 
    2818  
    2819 Chain information for 1c6n #111 
    2820 --- 
    2821 Chain | Description | UniProt 
    2822 A | PROTEIN (LYSOZYME) | LYCV_BPT4 1-164 
    2823  
    2824 Non-standard residues in 1c6n #111 
    2825 --- 
    2826 BME — β-mercaptoethanol 
    2827 CL — chloride ion 
    2828 XE — XENON 
    2829  
    2830 Deleted 10 C-terminal residues, 2 N-terminal residues, 51 non-polymer residues
    2831 more than 3.0 Angstroms away. 
    2832 Alignment of 1c6n chain A to query has RMSD 1.01 using 50 of 124 paired
    2833 residues within cutoff distance 2.0 
    2834 Fetching compressed mmCIF 5t04 from http://files.rcsb.org/download/5t04.cif 
    2835 Fetching CCD TCE from
    2836 https://files.wwpdb.org/pub/pdb/refdata/chem_comp/E/TCE/TCE.cif 
    2837 5t04 title: 
    2838 Structure of constitutively active neurotensin receptor [more info...] 
    2839  
    2840 Chain information for 5t04 #112 
    2841 --- 
    2842 Chain | Description | UniProt 
    2843 A | Neurotensin receptor type 1,Endolysin,Neurotensin receptor type 1 | NTR1_RAT 43-268 297-396, ENLYS_BPT4 1002-1161 
    2844 B | ARG-ARG-PRO-TYR-ILE-LEU |   
    2845  
    2846 Non-standard residues in 5t04 #112 
    2847 --- 
    2848 GOL — glycerol (glycerin; propane-1,2,3-triol) 
    2849 PEG — di(hydroxyethyl)ether 
    2850 TCE — 3,3',3''-phosphanetriyltripropanoic acid
    2851 (3-[bis(2-carboxyethyl)phosphanyl]propanoic acid) 
    2852  
    2853 3703 atoms have anisotropic B-factors. Depict anisotropic information with
    2854 Thermal Ellipsoids [start tool...] or the aniso command. 
    2855 Deleted 1 extra chains, 88 C-terminal residues, 215 N-terminal residues, 4
    2856 non-polymer residues more than 3.0 Angstroms away. 
    2857 Alignment of 5t04 chain A to query has RMSD 1.24 using 57 of 129 paired
    2858 residues within cutoff distance 2.0 
    2859 1g0j title: 
    2860 Crystal structure of T4 lysozyme mutant T152S [more info...] 
    2861  
    2862 Chain information for 1g0j #113 
    2863 --- 
    2864 Chain | Description | UniProt 
    2865 A | PROTEIN (LYSOZYME) | LYS_BPT4 1-164 
    2866  
    2867 Non-standard residues in 1g0j #113 
    2868 --- 
    2869 CL — chloride ion 
    2870 HED — 2-hydroxyethyl disulfide 
    2871  
    2872 Deleted 11 C-terminal residues, 2 N-terminal residues, 77 non-polymer residues
    2873 more than 3.0 Angstroms away. 
    2874 Alignment of 1g0j chain A to query has RMSD 1 using 49 of 125 paired residues
    2875 within cutoff distance 2.0 
    2876 Fetching compressed mmCIF 4pla from http://files.rcsb.org/download/4pla.cif 
    2877 4pla title: 
    2878 Crystal structure of phosphatidyl inositol 4-kinase II α in complex with ATP
    2879 [more info...] 
    2880  
    2881 Chain information for 4pla #114 
    2882 --- 
    2883 Chain | Description | UniProt 
    2884 A | Chimera protein of Phosphatidylinositol 4-kinase type 2-alpha and Lysozyme | P4K2A_HUMAN 76-172 180-468, D9IEF7_BPT4 1004-1166 
    2885  
    2886 Non-standard residues in 4pla #114 
    2887 --- 
    2888 ATP — adenosine-5'-triphosphate 
    2889  
    2890 Deleted 256 C-terminal residues, 73 N-terminal residues, 3 non-polymer
    2891 residues more than 3.0 Angstroms away. 
    2892 Alignment of 4pla chain A to query has RMSD 0.787 using 42 of 129 paired
    2893 residues within cutoff distance 2.0 
    2894 2ou9 title: 
    2895 Structure of Spin-labeled T4 Lysozyme Mutant T115R1/R119A [more info...] 
    2896  
    2897 Chain information for 2ou9 #115 
    2898 --- 
    2899 Chain | Description | UniProt 
    2900 A | Lysozyme | LYS_BPT4 1-164 
    2901  
    2902 Non-standard residues in 2ou9 #115 
    2903 --- 
    2904 MTN — S-[(1-oxyl-2,2,5,5-tetramethyl-2,5-dihydro-1H-pyrrol-3-yl)methyl]
    2905 methanesulfonothioate (MTSL) 
    2906  
    2907 Deleted 11 C-terminal residues, 2 N-terminal residues. 
    2908 Alignment of 2ou9 chain A to query has RMSD 0.947 using 48 of 124 paired
    2909 residues within cutoff distance 2.0 
    2910 1qt3 title: 
    2911 T26D mutant of T4 lysozyme [more info...] 
    2912  
    2913 Chain information for 1qt3 #116 
    2914 --- 
    2915 Chain | Description | UniProt 
    2916 A | PROTEIN (T4 Lysozyme) | LYS_BPT4 1-164 
    2917  
    2918 Non-standard residues in 1qt3 #116 
    2919 --- 
    2920 CL — chloride ion 
    2921 HED — 2-hydroxyethyl disulfide 
    2922  
    2923 Deleted 11 C-terminal residues, 2 N-terminal residues, 87 non-polymer residues
    2924 more than 3.0 Angstroms away. 
    2925 Alignment of 1qt3 chain A to query has RMSD 1.02 using 49 of 125 paired
    2926 residues within cutoff distance 2.0 
    2927 1qsb title: 
    2928 The introduction of strain and its effects on the structure and stability of
    2929 T4 lysozyme [more info...] 
    2930  
    2931 Chain information for 1qsb #117 
    2932 --- 
    2933 Chain | Description | UniProt 
    2934 A | PROTEIN (LYSOZYME) | LYS_BPT4 1-162 
    2935  
    2936 Non-standard residues in 1qsb #117 
    2937 --- 
    2938 CL — chloride ion 
    2939 HED — 2-hydroxyethyl disulfide 
    2940  
    2941 Deleted 9 C-terminal residues, 2 N-terminal residues, 60 non-polymer residues
    2942 more than 3.0 Angstroms away. 
    2943 Alignment of 1qsb chain A to query has RMSD 1.03 using 49 of 125 paired
    2944 residues within cutoff distance 2.0 
    2945 1l74 title: 
    2946 Multiple stabilizing alanine replacements within α-helix 126-134 of T4
    2947 lysozyme have independent, additive effects on both structure and stability
    2948 [more info...] 
    2949  
    2950 Chain information for 1l74 #118 
    2951 --- 
    2952 Chain | Description | UniProt 
    2953 A | LYSOZYME | LYS_BPT4 1-164 
    2954  
    2955 Non-standard residues in 1l74 #118 
    2956 --- 
    2957 BME — β-mercaptoethanol 
    2958 CL — chloride ion 
    2959  
    2960 5 atoms have alternate locations. Control/examine alternate locations with
    2961 Altloc Explorer [start tool...] or the altlocs command. 
    2962 Deleted 9 C-terminal residues, 2 N-terminal residues, 63 non-polymer residues
    2963 more than 3.0 Angstroms away. 
    2964 Alignment of 1l74 chain A to query has RMSD 1.02 using 47 of 125 paired
    2965 residues within cutoff distance 2.0 
    2966 1l01 title: 
    2967 Structural studies of mutants of the lysozyme of bacteriophage T4. The
    2968 temperature-sensitive mutant protein THR157 (right arrow) ile [more info...] 
    2969  
    2970 Chain information for 1l01 #119 
    2971 --- 
    2972 Chain | Description | UniProt 
    2973 A | T4 LYSOZYME | LYS_BPT4 1-164 
    2974  
    2975 Deleted 11 C-terminal residues, 2 N-terminal residues, 57 non-polymer residues
    2976 more than 3.0 Angstroms away. 
    2977 Alignment of 1l01 chain A to query has RMSD 1.04 using 49 of 124 paired
    2978 residues within cutoff distance 2.0 
    2979 1cv6 title: 
    2980 T4 lysozyme mutant V149M [more info...] 
    2981  
    2982 Chain information for 1cv6 #120 
    2983 --- 
    2984 Chain | Description | UniProt 
    2985 A | LYSOZYME | LYS_BPT4 1-164 
    2986  
    2987 Non-standard residues in 1cv6 #120 
    2988 --- 
    2989 CL — chloride ion 
    2990 HED — 2-hydroxyethyl disulfide 
    2991  
    2992 Deleted 9 C-terminal residues, 2 N-terminal residues, 60 non-polymer residues
    2993 more than 3.0 Angstroms away. 
    2994 Alignment of 1cv6 chain A to query has RMSD 1.06 using 50 of 127 paired
    2995 residues within cutoff distance 2.0 
    2996 197l title: 
    2997 Thermodynamic and structural compensation In "size-switch" core-repacking
    2998 variants of T4 lysozyme [more info...] 
    2999  
    3000 Chain information for 197l #121 
    3001 --- 
    3002 Chain | Description | UniProt 
    3003 A | LYSOZYME | LYCV_BPT4 1-164 
    3004  
    3005 Non-standard residues in 197l #121 
    3006 --- 
    3007 BME — β-mercaptoethanol 
    3008 CL — chloride ion 
    3009  
    3010 Deleted 9 C-terminal residues, 2 N-terminal residues, 42 non-polymer residues
    3011 more than 3.0 Angstroms away. 
    3012 Alignment of 197l chain A to query has RMSD 0.939 using 48 of 127 paired
    3013 residues within cutoff distance 2.0 
    3014 Fetching compressed mmCIF 110l from http://files.rcsb.org/download/110l.cif 
    3015 110l title: 
    3016 Structural basis of α-helix propensity At two sites In T4 lysozyme [more
    3017 info...] 
    3018  
    3019 Chain information for 110l #122 
    3020 --- 
    3021 Chain | Description | UniProt 
    3022 A | T4 LYSOZYME | LYCV_BPT4 1-164 
    3023  
    3024 Non-standard residues in 110l #122 
    3025 --- 
    3026 BME — β-mercaptoethanol 
    3027 CL — chloride ion 
    3028  
    3029 Deleted 9 C-terminal residues, 2 N-terminal residues, 67 non-polymer residues
    3030 more than 3.0 Angstroms away. 
    3031 Alignment of 110l chain A to query has RMSD 0.928 using 46 of 125 paired
    3032 residues within cutoff distance 2.0 
    3033 2hul title: 
    3034 Crystal structure of T4 Lysozyme S44C synthetic dimer [more info...] 
    3035  
    3036 Chain information for 2hul #123 
    3037 --- 
    3038 Chain | Description | UniProt 
    3039 A | Lysozyme | LYS_BPT4 1-164 
    3040  
    3041 Non-standard residues in 2hul #123 
    3042 --- 
    3043 GOL — glycerol (glycerin; propane-1,2,3-triol) 
    3044 SO4 — sulfate ion 
    3045  
    3046 2hul mmCIF Assemblies 
    3047 --- 
    3048 1| author_and_software_defined_assembly 
    3049 2| software_defined_assembly 
    3050  
    3051 24 atoms have alternate locations. Control/examine alternate locations with
    3052 Altloc Explorer [start tool...] or the altlocs command. 
    3053 Deleted 11 C-terminal residues, 2 N-terminal residues, 57 non-polymer residues
    3054 more than 3.0 Angstroms away. 
    3055 Alignment of 2hul chain A to query has RMSD 0.833 using 45 of 126 paired
    3056 residues within cutoff distance 2.0 
    3057 Fetching compressed mmCIF 1l55 from http://files.rcsb.org/download/1l55.cif 
    3058 1l55 title: 
    3059 Analysis of the interaction between charged side chains and the α-helix dipole
    3060 using designed thermostable mutants of phage T4 lysozyme [more info...] 
    3061  
    3062 Chain information for 1l55 #124 
    3063 --- 
    3064 Chain | Description | UniProt 
    3065 A | LYSOZYME | LYCV_BPT4 1-164 
    3066  
    3067 Non-standard residues in 1l55 #124 
    3068 --- 
    3069 BME — β-mercaptoethanol 
    3070 CL — chloride ion 
    3071  
    3072 Deleted 9 C-terminal residues, 2 N-terminal residues, 61 non-polymer residues
    3073 more than 3.0 Angstroms away. 
    3074 Alignment of 1l55 chain A to query has RMSD 0.894 using 45 of 125 paired
    3075 residues within cutoff distance 2.0 
    3076 Fetching compressed mmCIF 1d3n from http://files.rcsb.org/download/1d3n.cif 
    3077 1d3n title: 
    3078 Methionine core mutation [more info...] 
    3079  
    3080 Chain information for 1d3n #125 
    3081 --- 
    3082 Chain | Description | UniProt 
    3083 A | LYSOZYME | LYS_BPT4 1-164 
    3084  
    3085 Non-standard residues in 1d3n #125 
    3086 --- 
    3087 CL — chloride ion 
    3088 HED — 2-hydroxyethyl disulfide 
    3089  
    3090 Deleted 9 C-terminal residues, 2 N-terminal residues, 49 non-polymer residues
    3091 more than 3.0 Angstroms away. 
    3092 Alignment of 1d3n chain A to query has RMSD 0.883 using 44 of 125 paired
    3093 residues within cutoff distance 2.0 
    3094 3c81 title: 
    3095 Mutant K85A of T4 lysozyme in wildtype background at room temperature [more
    3096 info...] 
    3097  
    3098 Chain information for 3c81 #126 
    3099 --- 
    3100 Chain | Description | UniProt 
    3101 A | Lysozyme | LYS_BPT4 1-164 
    3102  
    3103 Non-standard residues in 3c81 #126 
    3104 --- 
    3105 BME — β-mercaptoethanol 
    3106 CL — chloride ion 
    3107  
    3108 36 atoms have alternate locations. Control/examine alternate locations with
    3109 Altloc Explorer [start tool...] or the altlocs command. 
    3110 Deleted 11 C-terminal residues, 2 N-terminal residues, 47 non-polymer residues
    3111 more than 3.0 Angstroms away. 
    3112 Alignment of 3c81 chain A to query has RMSD 0.984 using 47 of 125 paired
    3113 residues within cutoff distance 2.0 
    3114 3c7y title: 
    3115 Mutant R96A OF T4 lysozyme in wildtype background at 298K [more info...] 
    3116  
    3117 Chain information for 3c7y #127 
    3118 --- 
    3119 Chain | Description | UniProt 
    3120 A | lysozyme | LYS_BPT4 1-164 
    3121  
    3122 Non-standard residues in 3c7y #127 
    3123 --- 
    3124 BME — β-mercaptoethanol 
    3125 CL — chloride ion 
    3126  
    3127 23 atoms have alternate locations. Control/examine alternate locations with
    3128 Altloc Explorer [start tool...] or the altlocs command. 
    3129 Deleted 11 C-terminal residues, 2 N-terminal residues, 21 non-polymer residues
    3130 more than 3.0 Angstroms away. 
    3131 Alignment of 3c7y chain A to query has RMSD 0.972 using 47 of 124 paired
    3132 residues within cutoff distance 2.0 
    3133 206l title: 
    3134 Phage T4 lysozyme [more info...] 
    3135  
    3136 Chain information for 206l #128 
    3137 --- 
    3138 Chain | Description | UniProt 
    3139 A | LYSOZYME | LYS_BPT4 1-164 
    3140  
    3141 Non-standard residues in 206l #128 
    3142 --- 
    3143 BME — β-mercaptoethanol 
    3144 CL — chloride ion 
    3145  
    3146 Deleted 9 C-terminal residues, 2 N-terminal residues, 62 non-polymer residues
    3147 more than 3.0 Angstroms away. 
    3148 Alignment of 206l chain A to query has RMSD 1.02 using 49 of 127 paired
    3149 residues within cutoff distance 2.0 
    3150 1pqd title: 
    3151 T4 lysozyme core repacking mutant CORE10/Ta [more info...] 
    3152  
    3153 Chain information for 1pqd #129 
    3154 --- 
    3155 Chain | Description | UniProt 
    3156 A | Lysozyme | LYS_BPT4 1-164 
    3157  
    3158 Non-standard residues in 1pqd #129 
    3159 --- 
    3160 BME — β-mercaptoethanol 
    3161 CL — chloride ion 
    3162 K — potassium ion 
    3163  
    3164 11 atoms have alternate locations. Control/examine alternate locations with
    3165 Altloc Explorer [start tool...] or the altlocs command. 
    3166 Deleted 11 C-terminal residues, 2 N-terminal residues, 103 non-polymer
    3167 residues more than 3.0 Angstroms away. 
    3168 Alignment of 1pqd chain A to query has RMSD 1.21 using 51 of 124 paired
    3169 residues within cutoff distance 2.0 
    3170 1l48 title: 
    3171 Structural and thermodynamic analysis of the packing of two α-helices In
    3172 bacteriophage T4 lysozyme [more info...] 
    3173  
    3174 Chain information for 1l48 #130 
    3175 --- 
    3176 Chain | Description | UniProt 
    3177 A | T4 LYSOZYME | LYS_BPT4 1-164 
    3178  
    3179 Non-standard residues in 1l48 #130 
    3180 --- 
    3181 BME — β-mercaptoethanol 
    3182  
    3183 Deleted 11 C-terminal residues, 2 N-terminal residues, 67 non-polymer residues
    3184 more than 3.0 Angstroms away. 
    3185 Alignment of 1l48 chain A to query has RMSD 1.01 using 47 of 125 paired
    3186 residues within cutoff distance 2.0 
    3187 1jtm title: 
    3188 Alternative Structures of a Sequence Extended T4 Lysozyme Show that the Highly
    3189 Conserved Beta-Sheet has Weak Intrinsic Folding Propensity [more info...] 
    3190  
    3191 Chain information for 1jtm #131 
    3192 --- 
    3193 Chain | Description | UniProt 
    3194 A | LYSOZYME | LYS_BPT4 1-164 
    3195  
    3196 Non-standard residues in 1jtm #131 
    3197 --- 
    3198 BME — β-mercaptoethanol 
    3199  
    3200 Deleted 17 C-terminal residues, 2 N-terminal residues, 1 non-polymer residues
    3201 more than 3.0 Angstroms away. 
    3202 Alignment of 1jtm chain A to query has RMSD 1.02 using 50 of 129 paired
    3203 residues within cutoff distance 2.0 
    3204 1cv3 title: 
    3205 T4 lysozyme mutant L121M [more info...] 
    3206  
    3207 Chain information for 1cv3 #132 
    3208 --- 
    3209 Chain | Description | UniProt 
    3210 A | LYSOZYME | LYS_BPT4 1-164 
    3211  
    3212 Non-standard residues in 1cv3 #132 
    3213 --- 
    3214 CL — chloride ion 
    3215 HED — 2-hydroxyethyl disulfide 
    3216  
    3217 Deleted 9 C-terminal residues, 2 N-terminal residues, 61 non-polymer residues
    3218 more than 3.0 Angstroms away. 
    3219 Alignment of 1cv3 chain A to query has RMSD 0.997 using 48 of 125 paired
    3220 residues within cutoff distance 2.0 
    3221 147l title: 
    3222 Role of backbone flexibility In the accommodation of variants that repack the
    3223 core of T4 lysozyme [more info...] 
    3224  
    3225 Chain information for 147l #133 
    3226 --- 
    3227 Chain | Description | UniProt 
    3228 A | T4 LYSOZYME | LYCV_BPT4 1-164 
    3229  
    3230 Non-standard residues in 147l #133 
    3231 --- 
    3232 BME — β-mercaptoethanol 
    3233 CL — chloride ion 
    3234  
    3235 Deleted 9 C-terminal residues, 2 N-terminal residues, 54 non-polymer residues
    3236 more than 3.0 Angstroms away. 
    3237 Alignment of 147l chain A to query has RMSD 1.04 using 51 of 124 paired
    3238 residues within cutoff distance 2.0 
    3239 7lx8 title: 
    3240 T4 lysozyme mutant L99A [more info...] 
    3241  
    3242 Chain information for 7lx8 #134 
    3243 --- 
    3244 Chain | Description | UniProt 
    3245 A | Lysozyme | D9IEF7_BPT4 1-164 
    3246  
    3247 Non-standard residues in 7lx8 #134 
    3248 --- 
    3249 TRS — 2-amino-2-hydroxymethyl-propane-1,3-diol (tris buffer) 
    3250 YGV — 1-chloro-2-(methylsulfanyl)benzene 
    3251  
    3252 27 atoms have alternate locations. Control/examine alternate locations with
    3253 Altloc Explorer [start tool...] or the altlocs command. 
    3254 Deleted 9 C-terminal residues, 2 N-terminal residues, 38 non-polymer residues
    3255 more than 3.0 Angstroms away. 
    3256 Alignment of 7lx8 chain A to query has RMSD 0.995 using 47 of 125 paired
    3257 residues within cutoff distance 2.0 
    3258 4w56 title: 
    3259 T4 Lysozyme L99A with sec-Butylbenzene Bound [more info...] 
    3260  
    3261 Chain information for 4w56 #135 
    3262 --- 
    3263 Chain | Description | UniProt 
    3264 A | Endolysin | ENLYS_BPT4 1-164 
    3265  
    3266 Non-standard residues in 4w56 #135 
    3267 --- 
    3268 3GY — (2R)-butan-2-ylbenzene (sec-Butylbenzene) 
    3269 EPE — 4-(2-hydroxyethyl)-1-piperazine ethanesulfonic acid (HEPES) 
    3270  
    3271 132 atoms have alternate locations. Control/examine alternate locations with
    3272 Altloc Explorer [start tool...] or the altlocs command. 
    3273 Deleted 11 C-terminal residues, 2 N-terminal residues, 47 non-polymer residues
    3274 more than 3.0 Angstroms away. 
    3275 Alignment of 4w56 chain A to query has RMSD 0.904 using 43 of 124 paired
    3276 residues within cutoff distance 2.0 
    3277 Fetching compressed mmCIF 3sbb from http://files.rcsb.org/download/3sbb.cif 
    3278 3sbb title: 
    3279 Disulphide-mediated Tetramer of T4 Lysozyme R76C/R80C by Synthetic
    3280 Symmetrization [more info...] 
    3281  
    3282 Chain information for 3sbb #136 
    3283 --- 
    3284 Chain | Description | UniProt 
    3285 C | Lysozyme | LYS_BPT4 1-162 
    3286  
    3287 Non-standard residues in 3sbb #136 
    3288 --- 
    3289 CL — chloride ion 
    3290  
    3291 3sbb mmCIF Assemblies 
    3292 --- 
    3293 1| author_and_software_defined_assembly 
    3294  
    3295 38 atoms have alternate locations. Control/examine alternate locations with
    3296 Altloc Explorer [start tool...] or the altlocs command. 
    3297 1527 atoms have anisotropic B-factors. Depict anisotropic information with
    3298 Thermal Ellipsoids [start tool...] or the aniso command. 
    3299 Deleted 9 C-terminal residues, 3 N-terminal residues, 117 non-polymer residues
    3300 more than 3.0 Angstroms away. 
    3301 Alignment of 3sbb chain C to query has RMSD 1.26 using 61 of 124 paired
    3302 residues within cutoff distance 2.0 
    3303 3c82 title: 
    3304 Bacteriophage lysozyme T4 lysozyme mutant K85A/R96H [more info...] 
    3305  
    3306 Chain information for 3c82 #137 
    3307 --- 
    3308 Chain | Description | UniProt 
    3309 A | Lysozyme | LYS_BPT4 1-164 
    3310  
    3311 Non-standard residues in 3c82 #137 
    3312 --- 
    3313 BME — β-mercaptoethanol 
    3314 CL — chloride ion 
    3315  
    3316 33 atoms have alternate locations. Control/examine alternate locations with
    3317 Altloc Explorer [start tool...] or the altlocs command. 
    3318 Deleted 11 C-terminal residues, 2 N-terminal residues, 41 non-polymer residues
    3319 more than 3.0 Angstroms away. 
    3320 Alignment of 3c82 chain A to query has RMSD 1.02 using 48 of 125 paired
    3321 residues within cutoff distance 2.0 
    3322 1qud title: 
    3323 L99G mutant of T4 lysozyme [more info...] 
    3324  
    3325 Chain information for 1qud #138 
    3326 --- 
    3327 Chain | Description | UniProt 
    3328 A | PROTEIN (LYSOZYME) | LYS_BPT4 1-162 
    3329  
    3330 Non-standard residues in 1qud #138 
    3331 --- 
    3332 CL — chloride ion 
    3333 HEZ — hexane-1,6-diol 
    3334  
    3335 Deleted 9 C-terminal residues, 2 N-terminal residues, 44 non-polymer residues
    3336 more than 3.0 Angstroms away. 
    3337 Alignment of 1qud chain A to query has RMSD 0.961 using 46 of 127 paired
    3338 residues within cutoff distance 2.0 
    3339 Fetching compressed mmCIF 1p2r from http://files.rcsb.org/download/1p2r.cif 
    3340 1p2r title: 
    3341 T4 lysozyme core repacking mutant I78V/Ta [more info...] 
    3342  
    3343 Chain information for 1p2r #139 
    3344 --- 
    3345 Chain | Description | UniProt 
    3346 A | LYSOZYME | LYS_BPT4 1-164 
    3347  
    3348 Non-standard residues in 1p2r #139 
    3349 --- 
    3350 CL — chloride ion 
    3351 HED — 2-hydroxyethyl disulfide 
    3352 K — potassium ion 
    3353  
    3354 12 atoms have alternate locations. Control/examine alternate locations with
    3355 Altloc Explorer [start tool...] or the altlocs command. 
    3356 Deleted 11 C-terminal residues, 2 N-terminal residues, 90 non-polymer residues
    3357 more than 3.0 Angstroms away. 
    3358 Alignment of 1p2r chain A to query has RMSD 0.971 using 49 of 127 paired
    3359 residues within cutoff distance 2.0 
    3360 1l97 title: 
    3361 Structure of A hinge-bending bacteriophage T4 lysozyme mutant, ILE3-> pro
    3362 [more info...] 
    3363  
    3364 Chain information for 1l97 #140 
    3365 --- 
    3366 Chain | Description | UniProt 
    3367 A B | T4 LYSOZYME | LYS_BPT4 1-164 
    3368  
    3369 1l97 mmCIF Assemblies 
    3370 --- 
    3371 1| author_defined_assembly 
    3372 2| author_defined_assembly 
    3373  
    3374 Deleted 1 extra chains, 11 C-terminal residues, 2 N-terminal residues, 160
    3375 non-polymer residues more than 3.0 Angstroms away. 
    3376 Alignment of 1l97 chain B to query has RMSD 1.18 using 53 of 122 paired
    3377 residues within cutoff distance 2.0 
    3378 Fetching compressed mmCIF 1l95 from http://files.rcsb.org/download/1l95.cif 
    3379 1l95 title: 
    3380 Similar hydrophobic replacements of leu 99 and phe 153 within the core of T4
    3381 lysozyme have different structural and thermodynamic consequences [more
    3382 info...] 
    3383  
    3384 Chain information for 1l95 #141 
    3385 --- 
    3386 Chain | Description | UniProt 
    3387 A | T4 LYSOZYME | LYCV_BPT4 1-164 
    3388  
    3389 Non-standard residues in 1l95 #141 
    3390 --- 
    3391 BME — β-mercaptoethanol 
    3392 CL — chloride ion 
    3393  
    3394 Deleted 9 C-terminal residues, 2 N-terminal residues, 63 non-polymer residues
    3395 more than 3.0 Angstroms away. 
    3396 Alignment of 1l95 chain A to query has RMSD 0.846 using 45 of 126 paired
    3397 residues within cutoff distance 2.0 
    3398 Fetching compressed mmCIF 1l85 from http://files.rcsb.org/download/1l85.cif 
    3399 1l85 title: 
    3400 Similar hydrophobic replacements of leu 99 and phe 153 within the core of T4
    3401 lysozyme have different structural and thermodynamic consequences [more
    3402 info...] 
    3403  
    3404 Chain information for 1l85 #142 
    3405 --- 
    3406 Chain | Description | UniProt 
    3407 A | T4 LYSOZYME | LYCV_BPT4 1-164 
    3408  
    3409 Non-standard residues in 1l85 #142 
    3410 --- 
    3411 BME — β-mercaptoethanol 
    3412 CL — chloride ion 
    3413  
    3414 Deleted 9 C-terminal residues, 2 N-terminal residues, 55 non-polymer residues
    3415 more than 3.0 Angstroms away. 
    3416 Alignment of 1l85 chain A to query has RMSD 0.902 using 45 of 126 paired
    3417 residues within cutoff distance 2.0 
    3418 1jtn title: 
    3419 Alternative Structures of a Sequence Extended T4 Lysozyme Show that the Highly
    3420 Conserved Beta-Sheet Region has weak intrinsic Folding Propensity [more
    3421 info...] 
    3422  
    3423 Chain information for 1jtn #143 
    3424 --- 
    3425 Chain | Description | UniProt 
    3426 A B | LYSOZYME | LYS_BPT4 1-164 
    3427  
    3428 Non-standard residues in 1jtn #143 
    3429 --- 
    3430 SO4 — sulfate ion 
    3431  
    3432 1jtn mmCIF Assemblies 
    3433 --- 
    3434 1| author_defined_assembly 
    3435 2| author_defined_assembly 
    3436  
    3437 Deleted 1 extra chains, 24 C-terminal residues, 2 N-terminal residues, 112
    3438 non-polymer residues more than 3.0 Angstroms away. 
    3439 Alignment of 1jtn chain A to query has RMSD 0.962 using 47 of 125 paired
    3440 residues within cutoff distance 2.0 
    3441 1g0l title: 
    3442 Crystal structure of T4 lysozyme mutant T152V [more info...] 
    3443  
    3444 Chain information for 1g0l #144 
    3445 --- 
    3446 Chain | Description | UniProt 
    3447 A | PROTEIN (LYSOZYME) | LYS_BPT4 1-164 
    3448  
    3449 Non-standard residues in 1g0l #144 
    3450 --- 
    3451 CL — chloride ion 
    3452 HED — 2-hydroxyethyl disulfide 
    3453  
    3454 Deleted 11 C-terminal residues, 2 N-terminal residues, 91 non-polymer residues
    3455 more than 3.0 Angstroms away. 
    3456 Alignment of 1g0l chain A to query has RMSD 1.01 using 49 of 124 paired
    3457 residues within cutoff distance 2.0 
    3458 Fetching compressed mmCIF 1d9w from http://files.rcsb.org/download/1d9w.cif 
    3459 1d9w title: 
    3460 Bacteriophage T4 lysozyme mutant [more info...] 
    3461  
    3462 Chain information for 1d9w #145 
    3463 --- 
    3464 Chain | Description | UniProt 
    3465 A | PROTEIN (LYSOZYME) | LYS_BPT4 1-164 
    3466  
    3467 Non-standard residues in 1d9w #145 
    3468 --- 
    3469 BME — β-mercaptoethanol 
    3470  
    3471 Deleted 9 C-terminal residues, 2 N-terminal residues, 38 non-polymer residues
    3472 more than 3.0 Angstroms away. 
    3473 Alignment of 1d9w chain A to query has RMSD 0.959 using 46 of 127 paired
    3474 residues within cutoff distance 2.0 
    3475 1c6i title: 
    3476 T4 lysozyme mutant C54T/C97A/L99A In the presence of 8 atm argon [more
    3477 info...] 
    3478  
    3479 Chain information for 1c6i #146 
    3480 --- 
    3481 Chain | Description | UniProt 
    3482 A | PROTEIN (LYSOZYME) | LYCV_BPT4 1-164 
    3483  
    3484 Non-standard residues in 1c6i #146 
    3485 --- 
    3486 AR — ARGON 
    3487 BME — β-mercaptoethanol 
    3488 CL — chloride ion 
    3489  
    3490 Deleted 9 C-terminal residues, 2 N-terminal residues, 64 non-polymer residues
    3491 more than 3.0 Angstroms away. 
    3492 Alignment of 1c6i chain A to query has RMSD 0.998 using 48 of 125 paired
    3493 residues within cutoff distance 2.0 
    3494 125l title: 
    3495 The energetic cost and the structural consequences of burying A hydroxyl group
    3496 within the core of A protein determined from ala to ser and val to THR
    3497 substitutions In T4 lysozyme [more info...] 
    3498  
    3499 Chain information for 125l #147 
    3500 --- 
    3501 Chain | Description | UniProt 
    3502 A | T4 LYSOZYME | LYCV_BPT4 1-164 
    3503  
    3504 Non-standard residues in 125l #147 
    3505 --- 
    3506 BME — β-mercaptoethanol 
    3507 CL — chloride ion 
    3508  
    3509 Deleted 9 C-terminal residues, 2 N-terminal residues, 66 non-polymer residues
    3510 more than 3.0 Angstroms away. 
    3511 Alignment of 125l chain A to query has RMSD 1.04 using 50 of 124 paired
    3512 residues within cutoff distance 2.0 
    3513 108l title: 
    3514 Structural basis of α-helix propensity At two sites In T4 lysozyme [more
    3515 info...] 
    3516  
    3517 Chain information for 108l #148 
    3518 --- 
    3519 Chain | Description | UniProt 
    3520 A | T4 LYSOZYME | LYCV_BPT4 1-164 
    3521  
    3522 Non-standard residues in 108l #148 
    3523 --- 
    3524 BME — β-mercaptoethanol 
    3525 CL — chloride ion 
    3526  
    3527 Deleted 9 C-terminal residues, 2 N-terminal residues, 81 non-polymer residues
    3528 more than 3.0 Angstroms away. 
    3529 Alignment of 108l chain A to query has RMSD 0.942 using 47 of 125 paired
    3530 residues within cutoff distance 2.0 
    3531 Fetching compressed mmCIF 5v86 from http://files.rcsb.org/download/5v86.cif 
    3532 Fetching CCD 8ZA from
    3533 https://files.wwpdb.org/pub/pdb/refdata/chem_comp/A/8ZA/8ZA.cif 
    3534 5v86 title: 
    3535 Structure of DCN1 bound to NAcM-OPT [more info...] 
    3536  
    3537 Chain information for 5v86 #149 
    3538 --- 
    3539 Chain | Description | UniProt 
    3540 A | Lysozyme,DCN1-like protein 1 | D9IEF7_BPT4 1-164, DCNL1_HUMAN 1062-1259 
    3541  
    3542 Non-standard residues in 5v86 #149 
    3543 --- 
    3544 8ZA — N-benzyl-N-(1-butylpiperidin-4-yl)-N'-(3,4-dichlorophenyl)urea 
    3545  
    3546 48 atoms have alternate locations. Control/examine alternate locations with
    3547 Altloc Explorer [start tool...] or the altlocs command. 
    3548 2932 atoms have anisotropic B-factors. Depict anisotropic information with
    3549 Thermal Ellipsoids [start tool...] or the aniso command. 
    3550 Deleted 196 C-terminal residues, 13 N-terminal residues, 428 non-polymer
    3551 residues more than 3.0 Angstroms away. 
    3552 Alignment of 5v86 chain A to query has RMSD 1.29 using 76 of 124 paired
    3553 residues within cutoff distance 2.0 
    3554 1l93 title: 
    3555 Similar hydrophobic replacements of leu 99 and phe 153 within the core of T4
    3556 lysozyme have different structural and thermodynamic consequences [more
    3557 info...] 
    3558  
    3559 Chain information for 1l93 #150 
    3560 --- 
    3561 Chain | Description | UniProt 
    3562 A | T4 LYSOZYME | LYCV_BPT4 1-164 
    3563  
    3564 Non-standard residues in 1l93 #150 
    3565 --- 
    3566 BME — β-mercaptoethanol 
    3567 CL — chloride ion 
    3568  
    3569 Deleted 9 C-terminal residues, 2 N-terminal residues, 53 non-polymer residues
    3570 more than 3.0 Angstroms away. 
    3571 Alignment of 1l93 chain A to query has RMSD 1.08 using 50 of 124 paired
    3572 residues within cutoff distance 2.0 
    3573 1l35 title: 
    3574 Structure of A thermostable disulfide-bridge mutant of phage T4 lysozyme shows
    3575 that an engineered crosslink In A flexible region does not increase the
    3576 rigidity of the folded protein [more info...] 
    3577  
    3578 Chain information for 1l35 #151 
    3579 --- 
    3580 Chain | Description | UniProt 
    3581 A | T4 LYSOZYME | LYS_BPT4 1-163 
    3582  
    3583 Deleted 11 C-terminal residues, 2 N-terminal residues, 75 non-polymer residues
    3584 more than 3.0 Angstroms away. 
    3585 Alignment of 1l35 chain A to query has RMSD 1.02 using 49 of 124 paired
    3586 residues within cutoff distance 2.0 
    3587 1cv5 title: 
    3588 T4 lysozyme mutant L133M [more info...] 
    3589  
    3590 Chain information for 1cv5 #152 
    3591 --- 
    3592 Chain | Description | UniProt 
    3593 A | LYSOZYME | LYS_BPT4 1-164 
    3594  
    3595 Non-standard residues in 1cv5 #152 
    3596 --- 
    3597 CL — chloride ion 
    3598 HED — 2-hydroxyethyl disulfide 
    3599  
    3600 Deleted 9 C-terminal residues, 2 N-terminal residues, 48 non-polymer residues
    3601 more than 3.0 Angstroms away. 
    3602 Alignment of 1cv5 chain A to query has RMSD 1.01 using 47 of 125 paired
    3603 residues within cutoff distance 2.0 
    3604 3cdt title: 
    3605 Contributions of all 20 amino acids at site 96 to the stability and structure
    3606 of T4 lysozyme [more info...] 
    3607  
    3608 Chain information for 3cdt #153 
    3609 --- 
    3610 Chain | Description | UniProt 
    3611 A | Lysozyme | LYS_BPT4 1-164 
    3612  
    3613 Non-standard residues in 3cdt #153 
    3614 --- 
    3615 BME — β-mercaptoethanol 
    3616 CL — chloride ion 
    3617  
    3618 40 atoms have alternate locations. Control/examine alternate locations with
    3619 Altloc Explorer [start tool...] or the altlocs command. 
    3620 Deleted 11 C-terminal residues, 2 N-terminal residues, 41 non-polymer residues
    3621 more than 3.0 Angstroms away. 
    3622 Alignment of 3cdt chain A to query has RMSD 1 using 49 of 125 paired residues
    3623 within cutoff distance 2.0 
    3624 Fetching compressed mmCIF 3cdo from http://files.rcsb.org/download/3cdo.cif 
    3625 Fetching CCD MPD from
    3626 https://files.wwpdb.org/pub/pdb/refdata/chem_comp/D/MPD/MPD.cif 
    3627 3cdo title: 
    3628 Bacteriophage T4 lysozyme mutant R96V in wildtype background at low
    3629 temperature [more info...] 
    3630  
    3631 Chain information for 3cdo #154 
    3632 --- 
    3633 Chain | Description | UniProt 
    3634 A B C D | Lysozyme | LYS_BPT4 1-164 
    3635  
    3636 Non-standard residues in 3cdo #154 
    3637 --- 
    3638 HEZ — hexane-1,6-diol 
    3639 MPD — (4S)-2-methyl-2,4-pentanediol 
    3640 SO4 — sulfate ion 
    3641  
    3642 3cdo mmCIF Assemblies 
    3643 --- 
    3644 1| author_defined_assembly 
    3645 2| author_defined_assembly 
    3646 3| author_defined_assembly 
    3647 4| author_defined_assembly 
    3648  
    3649 165 atoms have alternate locations. Control/examine alternate locations with
    3650 Altloc Explorer [start tool...] or the altlocs command. 
    3651 Deleted 3 extra chains, 9 C-terminal residues, 2 N-terminal residues, 674 non-
    3652 polymer residues more than 3.0 Angstroms away. 
    3653 Alignment of 3cdo chain A to query has RMSD 1.31 using 59 of 124 paired
    3654 residues within cutoff distance 2.0 
    3655 255l title: 
    3656 Hydrolase [more info...] 
    3657  
    3658 Chain information for 255l #155 
    3659 --- 
    3660 Chain | Description | UniProt 
    3661 A | LYSOZYME | LYS_BPT4 1-164 
    3662  
    3663 Non-standard residues in 255l #155 
    3664 --- 
    3665 BME — β-mercaptoethanol 
    3666 CL — chloride ion 
    3667  
    3668 Deleted 11 C-terminal residues, 2 N-terminal residues, 80 non-polymer residues
    3669 more than 3.0 Angstroms away. 
    3670 Alignment of 255l chain A to query has RMSD 1.01 using 49 of 125 paired
    3671 residues within cutoff distance 2.0 
    3672 Fetching compressed mmCIF 1t8f from http://files.rcsb.org/download/1t8f.cif 
    3673 1t8f title: 
    3674 Crystal structure of phage T4 lysozyme mutant
    3675 R14A/K16A/I17A/K19A/T21A/E22A/C54T/C97A [more info...] 
    3676  
    3677 Chain information for 1t8f #156 
    3678 --- 
    3679 Chain | Description | UniProt 
    3680 A | Lysozyme | LYCV_BPT4 1-164 
    3681  
    3682 Non-standard residues in 1t8f #156 
    3683 --- 
    3684 BME — β-mercaptoethanol 
    3685 CL — chloride ion 
    3686  
    3687 Deleted 9 C-terminal residues, 2 N-terminal residues, 37 non-polymer residues
    3688 more than 3.0 Angstroms away. 
    3689 Alignment of 1t8f chain A to query has RMSD 0.892 using 46 of 127 paired
    3690 residues within cutoff distance 2.0 
    3691 1llh title: 
    3692 Are carboxy terminii of helices coded by the local sequence or by tertiary
    3693 structure contacts [more info...] 
    3694  
    3695 Chain information for 1llh #157 
    3696 --- 
    3697 Chain | Description | UniProt 
    3698 A | Lysozyme | LYS_BPT4 1-164 
    3699  
    3700 Non-standard residues in 1llh #157 
    3701 --- 
    3702 BME — β-mercaptoethanol 
    3703 CL — chloride ion 
    3704  
    3705 Deleted 9 C-terminal residues, 2 N-terminal residues, 17 non-polymer residues
    3706 more than 3.0 Angstroms away. 
    3707 Alignment of 1llh chain A to query has RMSD 0.985 using 48 of 126 paired
    3708 residues within cutoff distance 2.0 
    3709 1l38 title: 
    3710 Contributions of engineered surface salt bridges to the stability of T4
    3711 lysozyme determined by directed mutagenesis [more info...] 
    3712  
    3713 Chain information for 1l38 #158 
    3714 --- 
    3715 Chain | Description | UniProt 
    3716 A | T4 LYSOZYME | LYS_BPT4 1-164 
    3717  
    3718 Deleted 11 C-terminal residues, 2 N-terminal residues, 72 non-polymer residues
    3719 more than 3.0 Angstroms away. 
    3720 Alignment of 1l38 chain A to query has RMSD 1.03 using 49 of 125 paired
    3721 residues within cutoff distance 2.0 
    3722 1dyd title: 
    3723 Determination of α-helix propensity within the context of A folded protein:
    3724 sites 44 and 131 In bacteriophage T4 lysozyme [more info...] 
    3725  
    3726 Chain information for 1dyd #159 
    3727 --- 
    3728 Chain | Description | UniProt 
    3729 A | T4 LYSOZYME | LYS_BPT4 1-164 
    3730  
    3731 Non-standard residues in 1dyd #159 
    3732 --- 
    3733 BME — β-mercaptoethanol 
    3734 CL — chloride ion 
    3735  
    3736 Deleted 7 C-terminal residues, 2 N-terminal residues, 68 non-polymer residues
    3737 more than 3.0 Angstroms away. 
    3738 Alignment of 1dyd chain A to query has RMSD 0.963 using 46 of 127 paired
    3739 residues within cutoff distance 2.0 
    3740 161l title: 
    3741 Control of enzyme activity by an engineered disulfide bond [more info...] 
    3742  
    3743 Chain information for 161l #160 
    3744 --- 
    3745 Chain | Description | UniProt 
    3746 A | T4 LYSOZYME | LYCV_BPT4 1-164 
    3747  
    3748 Non-standard residues in 161l #160 
    3749 --- 
    3750 BME — β-mercaptoethanol 
    3751 CL — chloride ion 
    3752  
    3753 Deleted 9 C-terminal residues, 2 N-terminal residues, 65 non-polymer residues
    3754 more than 3.0 Angstroms away. 
    3755 Alignment of 161l chain A to query has RMSD 1.03 using 50 of 126 paired
    3756 residues within cutoff distance 2.0 
    3757 131l title: 
    3758 Structures of randomly generated mutants of T4 lysozyme show that protein
    3759 stability can Be enhanced by relaxation of strain and by improved hydrogen
    3760 bonding via bound solvent [more info...] 
    3761  
    3762 Chain information for 131l #161 
    3763 --- 
    3764 Chain | Description | UniProt 
    3765 A | T4 LYSOZYME | LYCV_BPT4 1-164 
    3766  
    3767 Non-standard residues in 131l #161 
    3768 --- 
    3769 BME — β-mercaptoethanol 
    3770 CL — chloride ion 
    3771  
    3772 Deleted 9 C-terminal residues, 2 N-terminal residues, 79 non-polymer residues
    3773 more than 3.0 Angstroms away. 
    3774 Alignment of 131l chain A to query has RMSD 0.912 using 46 of 125 paired
    3775 residues within cutoff distance 2.0 
    3776 8jwy title: 
    3777 Crystal structure of A2AR-T4L in complex with 2-118 [more info...] 
    3778  
    3779 Chain information for 8jwy #162 
    3780 --- 
    3781 Chain | Description | UniProt 
    3782 A | Adenosine receptor A2a,Endolysin | AA2AR_HUMAN 2-208 369-463, D9IEF7_BPT4 209-368 
    3783  
    3784 Non-standard residues in 8jwy #162 
    3785 --- 
    3786 CLR — cholesterol 
    3787 NA — sodium ion 
    3788 OLA — oleic acid 
    3789 OLC — (2R)-2,3-dihydroxypropyl (9Z)-octadec-9-enoate (1-Oleoyl-R-glycerol) 
    3790 VBF —
    3791 3-[2-azanyl-6-[2-oxidanylidene-1-[[6-(2-oxidanylpropan-2-yl)pyridin-2-yl]methyl]pyridin-4-yl]pyrimidin-4-yl]-2-methyl-
    3792 benzenecarbonitrile 
    3793  
    3794 Deleted 97 C-terminal residues, 200 N-terminal residues, 212 non-polymer
    3795 residues more than 3.0 Angstroms away. 
    3796 Alignment of 8jwy chain A to query has RMSD 1.08 using 58 of 126 paired
    3797 residues within cutoff distance 2.0 
    3798 7loc title: 
    3799 T4 lysozyme mutant L99A in complex with 1-bromanyl-4-fluoranyl-benzene [more
    3800 info...] 
    3801  
    3802 Chain information for 7loc #163 
    3803 --- 
    3804 Chain | Description | UniProt 
    3805 A | Lysozyme | D9IEF7_BPT4 1-164 
    3806  
    3807 Non-standard residues in 7loc #163 
    3808 --- 
    3809 BME — β-mercaptoethanol 
    3810 TRS — 2-amino-2-hydroxymethyl-propane-1,3-diol (tris buffer) 
    3811 Y87 — 1-bromanyl-4-fluoranyl-benzene 
    3812  
    3813 44 atoms have alternate locations. Control/examine alternate locations with
    3814 Altloc Explorer [start tool...] or the altlocs command. 
    3815 Deleted 10 C-terminal residues, 2 N-terminal residues, 41 non-polymer residues
    3816 more than 3.0 Angstroms away. 
    3817 Alignment of 7loc chain A to query has RMSD 0.947 using 45 of 125 paired
    3818 residues within cutoff distance 2.0 
    3819 6zg4 title: 
    3820 Structure of M1-StaR-T4L in complex with HTL0009936 at 2.35A [more info...] 
    3821  
    3822 Chain information for 6zg4 #164 
    3823 --- 
    3824 Chain | Description | UniProt 
    3825 A | Muscarinic acetylcholine receptor M1,Endolysin,Muscarinic acetylcholine receptor M1 | ACM1_HUMAN 27-219 354-438, ENLYS_BPT4 1002-1161 
    3826  
    3827 Non-standard residues in 6zg4 #164 
    3828 --- 
    3829 OLA — oleic acid 
    3830 PGE — triethylene glycol 
    3831 PO4 — phosphate ion 
    3832 QK8 — ethyl
    3833 (4~{S})-4-[4-[(1-methylcyclobutyl)carbamoyl]piperidin-1-yl]azepane-1-carboxylate 
    3834  
    3835 3556 atoms have anisotropic B-factors. Depict anisotropic information with
    3836 Thermal Ellipsoids [start tool...] or the aniso command. 
    3837 Deleted 93 C-terminal residues, 200 N-terminal residues, 68 non-polymer
    3838 residues more than 3.0 Angstroms away. 
    3839 Alignment of 6zg4 chain A to query has RMSD 1.04 using 56 of 129 paired
    3840 residues within cutoff distance 2.0 
    3841 5jwu title: 
    3842 T4 Lysozyme L99A/M102Q with 1,2-Dihydro-1,2-azaborine Bound [more info...] 
    3843  
    3844 Chain information for 5jwu #165 
    3845 --- 
    3846 Chain | Description | UniProt 
    3847 A | Endolysin | ENLYS_BPT4 1-164 
    3848  
    3849 Non-standard residues in 5jwu #165 
    3850 --- 
    3851 B20 — 1,2-dihydro-1,2-azaborinine (1,2-dihydro-1,2-azaborine) 
    3852 CL — chloride ion 
    3853  
    3854 96 atoms have alternate locations. Control/examine alternate locations with
    3855 Altloc Explorer [start tool...] or the altlocs command. 
    3856 Deleted 8 C-terminal residues, 2 N-terminal residues, 65 non-polymer residues
    3857 more than 3.0 Angstroms away. 
    3858 Alignment of 5jwu chain A to query has RMSD 0.952 using 44 of 127 paired
    3859 residues within cutoff distance 2.0 
    3860 Fetching compressed mmCIF 4pjz from http://files.rcsb.org/download/4pjz.cif 
    3861 Fetching CCD 3FG from
    3862 https://files.wwpdb.org/pub/pdb/refdata/chem_comp/G/3FG/3FG.cif 
    3863 Fetching CCD 3MY from
    3864 https://files.wwpdb.org/pub/pdb/refdata/chem_comp/Y/3MY/3MY.cif 
    3865 Fetching CCD AIB from
    3866 https://files.wwpdb.org/pub/pdb/refdata/chem_comp/B/AIB/AIB.cif 
    3867 Fetching CCD DAL from
    3868 https://files.wwpdb.org/pub/pdb/refdata/chem_comp/L/DAL/DAL.cif 
    3869 Fetching CCD GCS from
    3870 https://files.wwpdb.org/pub/pdb/refdata/chem_comp/S/GCS/GCS.cif 
    3871 Fetching CCD GHP from
    3872 https://files.wwpdb.org/pub/pdb/refdata/chem_comp/P/GHP/GHP.cif 
    3873 Fetching CCD MAN from
    3874 https://files.wwpdb.org/pub/pdb/refdata/chem_comp/N/MAN/MAN.cif 
    3875 Fetching CCD OMY from
    3876 https://files.wwpdb.org/pub/pdb/refdata/chem_comp/Y/OMY/OMY.cif 
    3877 Fetching CCD T55 from
    3878 https://files.wwpdb.org/pub/pdb/refdata/chem_comp/5/T55/T55.cif 
    3879 4pjz title: 
    3880 Crystal structure of T4 lysozyme-GSS-peptide In complex with teicoplanin-A2-2
    3881 [more info...] 
    3882  
    3883 Chain information for 4pjz #166 
    3884 --- 
    3885 Chain | Description | UniProt 
    3886 A | Lysozyme | D9IEF7_BPT4 1-164 
    3887 B | TEICOPLANIN-A2-2 |   
    3888  
    3889 Non-standard residues in 4pjz #166 
    3890 --- 
    3891 3FG — (2S)-amino(3,5-dihydroxyphenyl)ethanoic acid 
    3892 GCS — 2-amino-2-deoxy-beta-D-glucopyranose (beta-D-glucosamine;
    3893 2-amino-2-deoxy-beta-D-glucose; 2-amino-2-deoxy-D-glucose; 2-amino-2-deoxy-
    3894 glucose; D-GLUCOSAMINE) 
    3895 GOL — glycerol (glycerin; propane-1,2,3-triol) 
    3896 MAN — alpha-D-mannopyranose (alpha-D-mannose; D-mannose; mannose) 
    3897 NAG — 2-acetamido-2-deoxy-beta-D-glucopyranose (N-acetyl-beta-D-glucosamine;
    3898 2-acetamido-2-deoxy-beta-D-glucose; 2-acetamido-2-deoxy-D-glucose;
    3899 2-acetamido-2-deoxy-glucose; N-ACETYL-D-GLUCOSAMINE) 
    3900 PO4 — phosphate ion 
    3901 T55 — 8-methylnonanoic acid 
    3902  
    3903 15 atoms have alternate locations. Control/examine alternate locations with
    3904 Altloc Explorer [start tool...] or the altlocs command. 
    3905 Deleted 1 extra chains, 13 C-terminal residues, 2 N-terminal residues, 51 non-
    3906 polymer residues more than 3.0 Angstroms away. 
    3907 Alignment of 4pjz chain A to query has RMSD 0.889 using 45 of 124 paired
    3908 residues within cutoff distance 2.0 
    3909 4exm title: 
    3910 The crystal structure of an engineered phage lysin containing the binding
    3911 domain of pesticin and the killing domain of T4-lysozyme [more info...] 
    3912  
    3913 Chain information for 4exm #167 
    3914 --- 
    3915 Chain | Description | UniProt 
    3916 A B C D | Pesticin, Lysozyme Chimera | Q57159_YERPE 6-172, LYS_BPT4 173-334 
    3917  
    3918 4exm mmCIF Assemblies 
    3919 --- 
    3920 1| author_and_software_defined_assembly 
    3921 2| author_and_software_defined_assembly 
    3922  
    3923 9712 atoms have anisotropic B-factors. Depict anisotropic information with
    3924 Thermal Ellipsoids [start tool...] or the aniso command. 
    3925 Deleted 3 extra chains, 10 C-terminal residues, 167 N-terminal residues, 70
    3926 non-polymer residues more than 3.0 Angstroms away. 
    3927 Alignment of 4exm chain C to query has RMSD 1.11 using 52 of 127 paired
    3928 residues within cutoff distance 2.0 
    3929 227l title: 
    3930 Generating ligand binding sites In T4 lysozyme using deficiency-creating
    3931 substitutions [more info...] 
    3932  
    3933 Chain information for 227l #168 
    3934 --- 
    3935 Chain | Description | UniProt 
    3936 A | T4 LYSOZYME | LYCV_BPT4 1-164 
    3937  
    3938 Non-standard residues in 227l #168 
    3939 --- 
    3940 BME — β-mercaptoethanol 
    3941 BNZ — benzene 
    3942 CL — chloride ion 
    3943  
    3944 Deleted 9 C-terminal residues, 2 N-terminal residues, 56 non-polymer residues
    3945 more than 3.0 Angstroms away. 
    3946 Alignment of 227l chain A to query has RMSD 1.03 using 49 of 125 paired
    3947 residues within cutoff distance 2.0 
    3948 Fetching compressed mmCIF 1l89 from http://files.rcsb.org/download/1l89.cif 
    3949 1l89 title: 
    3950 Similar hydrophobic replacements of leu 99 and phe 153 within the core of T4
    3951 lysozyme have different structural and thermodynamic consequences [more
    3952 info...] 
    3953  
    3954 Chain information for 1l89 #169 
    3955 --- 
    3956 Chain | Description | UniProt 
    3957 A | T4 LYSOZYME | LYCV_BPT4 1-164 
    3958  
    3959 Non-standard residues in 1l89 #169 
    3960 --- 
    3961 BME — β-mercaptoethanol 
    3962 CL — chloride ion 
    3963  
    3964 Deleted 9 C-terminal residues, 2 N-terminal residues, 60 non-polymer residues
    3965 more than 3.0 Angstroms away. 
    3966 Alignment of 1l89 chain A to query has RMSD 1.07 using 51 of 125 paired
    3967 residues within cutoff distance 2.0 
    3968 1dyf title: 
    3969 Determination of α-helix propensity within the context of A folded protein:
    3970 sites 44 and 131 In bacteriophage T4 lysozyme [more info...] 
    3971  
    3972 Chain information for 1dyf #170 
    3973 --- 
    3974 Chain | Description | UniProt 
    3975 A | T4 LYSOZYME | LYS_BPT4 1-164 
    3976  
    3977 Non-standard residues in 1dyf #170 
    3978 --- 
    3979 BME — β-mercaptoethanol 
    3980 CL — chloride ion 
    3981  
    3982 Deleted 9 C-terminal residues, 2 N-terminal residues, 73 non-polymer residues
    3983 more than 3.0 Angstroms away. 
    3984 Alignment of 1dyf chain A to query has RMSD 0.976 using 47 of 127 paired
    3985 residues within cutoff distance 2.0 
    3986 Fetching compressed mmCIF 166l from http://files.rcsb.org/download/166l.cif 
    3987 166l title: 
    3988 Control of enzyme activity by an engineered disulfide bond [more info...] 
    3989  
    3990 Chain information for 166l #171 
    3991 --- 
    3992 Chain | Description | UniProt 
    3993 A | T4 LYSOZYME | LYCV_BPT4 1-164 
    3994  
    3995 Non-standard residues in 166l #171 
    3996 --- 
    3997 BME — β-mercaptoethanol 
    3998 CL — chloride ion 
    3999  
    4000 Deleted 9 C-terminal residues, 2 N-terminal residues, 57 non-polymer residues
    4001 more than 3.0 Angstroms away. 
    4002 Alignment of 166l chain A to query has RMSD 1.03 using 49 of 125 paired
    4003 residues within cutoff distance 2.0 
    4004 4w58 title: 
    4005 T4 Lysozyme L99A with n-Pentylbenzene Bound [more info...] 
    4006  
    4007 Chain information for 4w58 #172 
    4008 --- 
    4009 Chain | Description | UniProt 
    4010 A | Endolysin | ENLYS_BPT4 1-164 
    4011  
    4012 Non-standard residues in 4w58 #172 
    4013 --- 
    4014 3H2 — pentylbenzene 
    4015 EPE — 4-(2-hydroxyethyl)-1-piperazine ethanesulfonic acid (HEPES) 
    4016  
    4017 161 atoms have alternate locations. Control/examine alternate locations with
    4018 Altloc Explorer [start tool...] or the altlocs command. 
    4019 Deleted 12 C-terminal residues, 2 N-terminal residues, 39 non-polymer residues
    4020 more than 3.0 Angstroms away. 
    4021 Alignment of 4w58 chain A to query has RMSD 0.996 using 46 of 124 paired
    4022 residues within cutoff distance 2.0 
    4023 3c7z title: 
    4024 T4 lysozyme mutant D89A/R96H at room temperature [more info...] 
    4025  
    4026 Chain information for 3c7z #173 
    4027 --- 
    4028 Chain | Description | UniProt 
    4029 A | Lysozyme | LYS_BPT4 1-164 
    4030  
    4031 Non-standard residues in 3c7z #173 
    4032 --- 
    4033 BME — β-mercaptoethanol 
    4034 CL — chloride ion 
    4035  
    4036 29 atoms have alternate locations. Control/examine alternate locations with
    4037 Altloc Explorer [start tool...] or the altlocs command. 
    4038 Deleted 11 C-terminal residues, 2 N-terminal residues, 26 non-polymer residues
    4039 more than 3.0 Angstroms away. 
    4040 Alignment of 3c7z chain A to query has RMSD 0.984 using 48 of 127 paired
    4041 residues within cutoff distance 2.0 
    4042 1qt7 title: 
    4043 E11N Mutant of T4 Lysozyme [more info...] 
    4044  
    4045 Chain information for 1qt7 #174 
    4046 --- 
    4047 Chain | Description | UniProt 
    4048 A | PROTEIN (T4 LYSOZYME) | LYS_BPT4 1-164 
    4049  
    4050 Non-standard residues in 1qt7 #174 
    4051 --- 
    4052 BME — β-mercaptoethanol 
    4053 CL — chloride ion 
    4054  
    4055 Deleted 11 C-terminal residues, 2 N-terminal residues, 86 non-polymer residues
    4056 more than 3.0 Angstroms away. 
    4057 Alignment of 1qt7 chain A to query has RMSD 1 using 48 of 125 paired residues
    4058 within cutoff distance 2.0 
    4059 196l title: 
    4060 Thermodynamic and structural compensation In "size-switch" core-repacking
    4061 variants of T4 lysozyme [more info...] 
    4062  
    4063 Chain information for 196l #175 
    4064 --- 
    4065 Chain | Description | UniProt 
    4066 A | LYSOZYME | LYCV_BPT4 1-164 
    4067  
    4068 Non-standard residues in 196l #175 
    4069 --- 
    4070 BME — β-mercaptoethanol 
    4071 CL — chloride ion 
    4072  
    4073 Deleted 9 C-terminal residues, 2 N-terminal residues, 61 non-polymer residues
    4074 more than 3.0 Angstroms away. 
    4075 Alignment of 196l chain A to query has RMSD 1.03 using 49 of 124 paired
    4076 residues within cutoff distance 2.0 
    4077 189l title: 
    4078 Enhancement of protein stability by the combination of point mutations In T4
    4079 lysozyme is additive [more info...] 
    4080  
    4081 Chain information for 189l #176 
    4082 --- 
    4083 Chain | Description | UniProt 
    4084 A | T4 LYSOZYME | LYS_BPT4 1-164 
    4085  
    4086 Deleted 11 C-terminal residues, 2 N-terminal residues, 24 non-polymer residues
    4087 more than 3.0 Angstroms away. 
    4088 Alignment of 189l chain A to query has RMSD 1.26 using 57 of 127 paired
    4089 residues within cutoff distance 2.0 
    4090 7z36 title: 
    4091 Crystal structure of the KAP1 tripartite motif in complex with the ZNF93 KRAB
    4092 domain [more info...] 
    4093  
    4094 Chain information for 7z36 #177 
    4095 --- 
    4096 Chain | Description | UniProt 
    4097 A B | Endolysin,Transcription intermediary factor 1-beta,Isoform 2 of Transcription intermediary factor 1-beta | ENLYS_BPT4 26-185, TIF1B_HUMAN 187-271, TIF1B-2_HUMAN 272-482 
    4098 C S | SMARCAD1 CUE1 domain |   
    4099 D | Zinc finger protein 93 | ZNF93_HUMAN 2-71 
    4100  
    4101 Non-standard residues in 7z36 #177 
    4102 --- 
    4103 ZN — zinc ion 
    4104  
    4105 7889 atoms have anisotropic B-factors. Depict anisotropic information with
    4106 Thermal Ellipsoids [start tool...] or the aniso command. 
    4107 Deleted 4 extra chains, 284 C-terminal residues, 1 N-terminal residues, 8 non-
    4108 polymer residues more than 3.0 Angstroms away. 
    4109 Alignment of 7z36 chain B to query has RMSD 1.13 using 54 of 135 paired
    4110 residues within cutoff distance 2.0 
    4111 7lx9 title: 
    4112 T4 lysozyme mutant L99A [more info...] 
    4113  
    4114 Chain information for 7lx9 #178 
    4115 --- 
    4116 Chain | Description | UniProt 
    4117 A | Lysozyme | D9IEF7_BPT4 1-164 
    4118  
    4119 Non-standard residues in 7lx9 #178 
    4120 --- 
    4121 TRS — 2-amino-2-hydroxymethyl-propane-1,3-diol (tris buffer) 
    4122 YGM — (but-3-en-1-yl)benzene 
    4123  
    4124 5 atoms have alternate locations. Control/examine alternate locations with
    4125 Altloc Explorer [start tool...] or the altlocs command. 
    4126 Deleted 9 C-terminal residues, 2 N-terminal residues, 31 non-polymer residues
    4127 more than 3.0 Angstroms away. 
    4128 Alignment of 7lx9 chain A to query has RMSD 0.917 using 44 of 123 paired
    4129 residues within cutoff distance 2.0 
    4130 5lwo title: 
    4131 Structure of Spin-labelled T4 lysozyme mutant L115C-R119C-R1 at 100K [more
    4132 info...] 
    4133  
    4134 Chain information for 5lwo #179 
    4135 --- 
    4136 Chain | Description | UniProt 
    4137 A | Endolysin | ENLYS_BPT4 1-164 
    4138  
    4139 Non-standard residues in 5lwo #179 
    4140 --- 
    4141 BME — β-mercaptoethanol 
    4142 CL — chloride ion 
    4143 HED — 2-hydroxyethyl disulfide 
    4144 K — potassium ion 
    4145 PO4 — phosphate ion 
    4146 RXR —
    4147 [2,2,5,5-tetramethyl-3,4-bis(sulfanylmethyl)-2,5-dihydro-1H-pyrrol-1-yl]oxidanyl
    4148 radical (3,4-bis(thiomethyl)-2,2,5,5-tetramethyl-1H-Pyrrol-1-yloxyl radical) 
    4149  
    4150 511 atoms have alternate locations. Control/examine alternate locations with
    4151 Altloc Explorer [start tool...] or the altlocs command. 
    4152 1340 atoms have anisotropic B-factors. Depict anisotropic information with
    4153 Thermal Ellipsoids [start tool...] or the aniso command. 
    4154 Deleted 11 C-terminal residues, 2 N-terminal residues, 60 non-polymer residues
    4155 more than 3.0 Angstroms away. 
    4156 Alignment of 5lwo chain A to query has RMSD 0.973 using 49 of 124 paired
    4157 residues within cutoff distance 2.0 
    4158 4phu title: 
    4159 Crystal structure of Human GPR40 bound to allosteric agonist TAK-875 [more
    4160 info...] 
    4161  
    4162 Chain information for 4phu #180 
    4163 --- 
    4164 Chain | Description | UniProt 
    4165 A | Free fatty acid receptor 1,Lysozyme | FFAR1_HUMAN 1-211 2214-2300, LYS_BPT4 1002-1161 
    4166  
    4167 Non-standard residues in 4phu #180 
    4168 --- 
    4169 1PE — pentaethylene glycol (PEG400) 
    4170 2YB —
    4171 [(3S)-6-({2',6'-dimethyl-4'-[3-(methylsulfonyl)propoxy]biphenyl-3-yl}methoxy)-2,3-dihydro-1-benzofuran-3-yl]acetic
    4172 acid 
    4173 DMS — dimethyl sulfoxide 
    4174 OLC — (2R)-2,3-dihydroxypropyl (9Z)-octadec-9-enoate (1-Oleoyl-R-glycerol) 
    4175  
    4176 14 atoms have alternate locations. Control/examine alternate locations with
    4177 Altloc Explorer [start tool...] or the altlocs command. 
    4178 3264 atoms have anisotropic B-factors. Depict anisotropic information with
    4179 Thermal Ellipsoids [start tool...] or the aniso command. 
    4180 Deleted 77 C-terminal residues, 206 N-terminal residues, 77 non-polymer
    4181 residues more than 3.0 Angstroms away. 
    4182 Alignment of 4phu chain A to query has RMSD 0.953 using 47 of 125 paired
    4183 residues within cutoff distance 2.0 
    4184 Fetching compressed mmCIF 3qak from http://files.rcsb.org/download/3qak.cif 
    4185 3qak title: 
    4186 Agonist bound structure of the human adenosine A2a receptor [more info...] 
    4187  
    4188 Chain information for 3qak #181 
    4189 --- 
    4190 Chain | Description | UniProt 
    4191 A | Adenosine receptor A2a,lysozyme chimera | AA2AR_HUMAN 2-208 222-316, LYS_BPT4 1002-1161 
    4192  
    4193 Non-standard residues in 3qak #181 
    4194 --- 
    4195 OLC — (2R)-2,3-dihydroxypropyl (9Z)-octadec-9-enoate (1-Oleoyl-R-glycerol) 
    4196 UKA —
    4197 6-(2,2-diphenylethylamino)-9-[(2R,3R,4S,5S)-5-(ethylcarbamoyl)-3,4-dihydroxy-
    4198 oxolan-2-yl]-N-[2-[(1-pyridin-2-ylpiperidin-4-yl)carbamoylamino]ethyl]purine-2-carboxamide 
    4199  
    4200 3480 atoms have anisotropic B-factors. Depict anisotropic information with
    4201 Thermal Ellipsoids [start tool...] or the aniso command. 
    4202 Deleted 95 C-terminal residues, 198 N-terminal residues, 7 non-polymer
    4203 residues more than 3.0 Angstroms away. 
    4204 Alignment of 3qak chain A to query has RMSD 1.17 using 62 of 125 paired
    4205 residues within cutoff distance 2.0 
    4206 3cdq title: 
    4207 Contributions of all 20 amino acids at site 96 to the stability and structure
    4208 of T4 lysozyme [more info...] 
    4209  
    4210 Chain information for 3cdq #182 
    4211 --- 
    4212 Chain | Description | UniProt 
    4213 A | Lysozyme | LYS_BPT4 1-164 
    4214  
    4215 Non-standard residues in 3cdq #182 
    4216 --- 
    4217 BME — β-mercaptoethanol 
    4218 CL — chloride ion 
    4219 K — potassium ion 
    4220  
    4221 41 atoms have alternate locations. Control/examine alternate locations with
    4222 Altloc Explorer [start tool...] or the altlocs command. 
    4223 Deleted 11 C-terminal residues, 2 N-terminal residues, 32 non-polymer residues
    4224 more than 3.0 Angstroms away. 
    4225 Alignment of 3cdq chain A to query has RMSD 0.991 using 48 of 125 paired
    4226 residues within cutoff distance 2.0 
    4227 1pqj title: 
    4228 T4 lysozyme core repacking mutant A111V/CORE10/Ta [more info...] 
    4229  
    4230 Chain information for 1pqj #183 
    4231 --- 
    4232 Chain | Description | UniProt 
    4233 A | Lysozyme | LYS_BPT4 1-164 
    4234  
    4235 Non-standard residues in 1pqj #183 
    4236 --- 
    4237 CL — chloride ion 
    4238 HED — 2-hydroxyethyl disulfide 
    4239 K — potassium ion 
    4240  
    4241 24 atoms have alternate locations. Control/examine alternate locations with
    4242 Altloc Explorer [start tool...] or the altlocs command. 
    4243 Deleted 11 C-terminal residues, 2 N-terminal residues, 73 non-polymer residues
    4244 more than 3.0 Angstroms away. 
    4245 Alignment of 1pqj chain A to query has RMSD 0.926 using 44 of 124 paired
    4246 residues within cutoff distance 2.0 
    4247 1lpy title: 
    4248 Multiple Methionine Substitutions in T4 Lysozyme [more info...] 
    4249  
    4250 Chain information for 1lpy #184 
    4251 --- 
    4252 Chain | Description | UniProt 
    4253 A | LYSOZYME | LYS_BPT4 1-164 
    4254  
    4255 Non-standard residues in 1lpy #184 
    4256 --- 
    4257 BME — β-mercaptoethanol 
    4258 CL — chloride ion 
    4259 PO4 — phosphate ion 
    4260  
    4261 12 atoms have alternate locations. Control/examine alternate locations with
    4262 Altloc Explorer [start tool...] or the altlocs command. 
    4263 Deleted 9 C-terminal residues, 2 N-terminal residues, 45 non-polymer residues
    4264 more than 3.0 Angstroms away. 
    4265 Alignment of 1lpy chain A to query has RMSD 1.11 using 50 of 126 paired
    4266 residues within cutoff distance 2.0 
    4267 1l70 title: 
    4268 Multiple stabilizing alanine replacements within α-helix 126-134 of T4
    4269 lysozyme have independent, additive effects on both structure and stability
    4270 [more info...] 
    4271  
    4272 Chain information for 1l70 #185 
    4273 --- 
    4274 Chain | Description | UniProt 
    4275 A | LYSOZYME | LYS_BPT4 1-164 
    4276  
    4277 Non-standard residues in 1l70 #185 
    4278 --- 
    4279 BME — β-mercaptoethanol 
    4280 CL — chloride ion 
    4281  
    4282 Deleted 9 C-terminal residues, 2 N-terminal residues, 72 non-polymer residues
    4283 more than 3.0 Angstroms away. 
    4284 Alignment of 1l70 chain A to query has RMSD 0.942 using 45 of 125 paired
    4285 residues within cutoff distance 2.0 
    4286 1l52 title: 
    4287 Structural and thermodynamic analysis of the packing of two α-helices In
    4288 bacteriophage T4 lysozyme [more info...] 
    4289  
    4290 Chain information for 1l52 #186 
    4291 --- 
    4292 Chain | Description | UniProt 
    4293 A | T4 LYSOZYME | LYS_BPT4 1-164 
    4294  
    4295 Deleted 11 C-terminal residues, 2 N-terminal residues, 76 non-polymer residues
    4296 more than 3.0 Angstroms away. 
    4297 Alignment of 1l52 chain A to query has RMSD 0.99 using 47 of 125 paired
    4298 residues within cutoff distance 2.0 
    4299 1l43 title: 
    4300 Cumulative site-directed charge-change replacements In bacteriophage T4
    4301 lysozyme suggest that long-range electrostatic interactions contribute little
    4302 to protein stability [more info...] 
    4303  
    4304 Chain information for 1l43 #187 
    4305 --- 
    4306 Chain | Description | UniProt 
    4307 A | T4 LYSOZYME | LYS_BPT4 1-164 
    4308  
    4309 Deleted 11 C-terminal residues, 2 N-terminal residues, 66 non-polymer residues
    4310 more than 3.0 Angstroms away. 
    4311 Alignment of 1l43 chain A to query has RMSD 0.999 using 48 of 126 paired
    4312 residues within cutoff distance 2.0 
    4313 1l22 title: 
    4314 Contributions of left-handed helical residues to the structure and stability
    4315 of bacteriophage T4 lysozyme [more info...] 
    4316  
    4317 Chain information for 1l22 #188 
    4318 --- 
    4319 Chain | Description | UniProt 
    4320 A | T4 LYSOZYME | LYS_BPT4 1-164 
    4321  
    4322 Deleted 11 C-terminal residues, 2 N-terminal residues, 74 non-polymer residues
    4323 more than 3.0 Angstroms away. 
    4324 Alignment of 1l22 chain A to query has RMSD 1.02 using 48 of 125 paired
    4325 residues within cutoff distance 2.0 
    4326 1l05 title: 
    4327 Contributions of hydrogen bonds of THR 157 to the thermodynamic stability of
    4328 phage T4 lysozyme [more info...] 
    4329  
    4330 Chain information for 1l05 #189 
    4331 --- 
    4332 Chain | Description | UniProt 
    4333 A | T4 LYSOZYME | LYS_BPT4 1-164 
    4334  
    4335 Deleted 11 C-terminal residues, 2 N-terminal residues, 62 non-polymer residues
    4336 more than 3.0 Angstroms away. 
    4337 Alignment of 1l05 chain A to query has RMSD 0.996 using 48 of 125 paired
    4338 residues within cutoff distance 2.0 
    4339 1cu2 title: 
    4340 T4 lysozyme mutant L84M [more info...] 
    4341  
    4342 Chain information for 1cu2 #190 
    4343 --- 
    4344 Chain | Description | UniProt 
    4345 A | LYSOZYME | LYS_BPT4 1-164 
    4346  
    4347 Non-standard residues in 1cu2 #190 
    4348 --- 
    4349 CL — chloride ion 
    4350 HED — 2-hydroxyethyl disulfide 
    4351  
    4352 Deleted 9 C-terminal residues, 2 N-terminal residues, 62 non-polymer residues
    4353 more than 3.0 Angstroms away. 
    4354 Alignment of 1cu2 chain A to query has RMSD 0.911 using 46 of 125 paired
    4355 residues within cutoff distance 2.0 
    4356 6iih title: 
    4357 crystal structure of mitochondrial calcium uptake 2(MICU2) [more info...] 
    4358  
    4359 Chain information for 6iih #191 
    4360 --- 
    4361 Chain | Description | UniProt 
    4362 A B | Endolysin,Calcium uptake protein 2, mitochondrial | ENLYS_BPT4 1-161, MICU2_HUMAN 164-485 
    4363  
    4364 Non-standard residues in 6iih #191 
    4365 --- 
    4366 CA — calcium ion 
    4367  
    4368 Deleted 1 extra chains, 284 C-terminal residues, 2 N-terminal residues, 764
    4369 non-polymer residues more than 3.0 Angstroms away. 
    4370 Alignment of 6iih chain B to query has RMSD 0.929 using 46 of 125 paired
    4371 residues within cutoff distance 2.0 
    4372 Fetching compressed mmCIF 5cgc from http://files.rcsb.org/download/5cgc.cif 
    4373 Fetching CCD 51D from
    4374 https://files.wwpdb.org/pub/pdb/refdata/chem_comp/D/51D/51D.cif 
    4375 Fetching CCD MES from
    4376 https://files.wwpdb.org/pub/pdb/refdata/chem_comp/S/MES/MES.cif 
    4377 5cgc title: 
    4378 Structure of the human class C GPCR metabotropic glutamate receptor 5
    4379 transmembrane domain in complex with the negative allosteric modulator
    4380 3-chloro-4-fluoro-5-[6-(1H-pyrazol-1-yl)pyrimidin-4-yl]benzonitrile [more
    4381 info...] 
    4382  
    4383 Chain information for 5cgc #192 
    4384 --- 
    4385 Chain | Description | UniProt 
    4386 A | Metabotropic glutamate receptor 5,Endolysin,Metabotropic glutamate receptor 5 | GRM5_HUMAN 569-678 679-836, ENLYS_BPT4 1002-1161 
    4387  
    4388 Non-standard residues in 5cgc #192 
    4389 --- 
    4390 51D — 3-chloro-4-fluoro-5-[6-(1H-pyrazol-1-yl)pyrimidin-4-yl]benzonitrile 
    4391 MES — 2-(N-morpholino)-ethanesulfonic acid 
    4392 OLA — oleic acid 
    4393  
    4394 Deleted 146 C-terminal residues, 112 N-terminal residues, 44 non-polymer
    4395 residues more than 3.0 Angstroms away. 
    4396 Alignment of 5cgc chain A to query has RMSD 1.15 using 66 of 125 paired
    4397 residues within cutoff distance 2.0 
    4398 Fetching compressed mmCIF 4tn3 from http://files.rcsb.org/download/4tn3.cif 
    4399 4tn3 title: 
    4400 Structure of the BBox-Coiled-coil region of Rhesus Trim5alpha [more info...] 
    4401  
    4402 Chain information for 4tn3 #193 
    4403 --- 
    4404 Chain | Description | UniProt 
    4405 A B | TRIM5/cyclophilin A fusion protein/T4 Lysozyme chimera | G9MAP5_MACMU 88-303, ENLYS_BPT4 304-467 
    4406  
    4407 Non-standard residues in 4tn3 #193 
    4408 --- 
    4409 ZN — zinc ion 
    4410  
    4411 Deleted 1 extra chains, 11 C-terminal residues, 159 N-terminal residues, 4
    4412 non-polymer residues more than 3.0 Angstroms away. 
    4413 Alignment of 4tn3 chain A to query has RMSD 1.03 using 48 of 160 paired
    4414 residues within cutoff distance 2.0 
    4415 Fetching compressed mmCIF 3rze from http://files.rcsb.org/download/3rze.cif 
    4416 Fetching CCD 5EH from
    4417 https://files.wwpdb.org/pub/pdb/refdata/chem_comp/H/5EH/5EH.cif 
    4418 Fetching CCD D7V from
    4419 https://files.wwpdb.org/pub/pdb/refdata/chem_comp/V/D7V/D7V.cif 
    4420 3rze title: 
    4421 Structure of the human histamine H1 receptor in complex with doxepin [more
    4422 info...] 
    4423  
    4424 Chain information for 3rze #194 
    4425 --- 
    4426 Chain | Description | UniProt 
    4427 A | Histamine H1 receptor, Lysozyme chimera | HRH1_HUMAN 20-221 405-487, LYS_BPT4 1002-1161 
    4428  
    4429 Non-standard residues in 3rze #194 
    4430 --- 
    4431 5EH — (3E)-3-(dibenzo[b,e]oxepin-11(6H)-ylidene)-N,N-dimethylpropan-1-amine 
    4432 D7V — (3Z)-3-(dibenzo[b,e]oxepin-11(6H)-ylidene)-N,N-dimethylpropan-1-amine 
    4433 OLC — (2R)-2,3-dihydroxypropyl (9Z)-octadec-9-enoate (1-Oleoyl-R-glycerol) 
    4434 PO4 — phosphate ion 
    4435  
    4436 42 atoms have alternate locations. Control/examine alternate locations with
    4437 Altloc Explorer [start tool...] or the altlocs command. 
    4438 3481 atoms have anisotropic B-factors. Depict anisotropic information with
    4439 Thermal Ellipsoids [start tool...] or the aniso command. 
    4440 Deleted 89 C-terminal residues, 188 N-terminal residues, 4 non-polymer
    4441 residues more than 3.0 Angstroms away. 
    4442 Alignment of 3rze chain A to query has RMSD 1.09 using 56 of 126 paired
    4443 residues within cutoff distance 2.0 
    4444 3lzm title: 
    4445 Structural studies of mutants of T4 lysozyme that alter hydrophobic
    4446 stabilization [more info...] 
    4447  
    4448 Chain information for 3lzm #195 
    4449 --- 
    4450 Chain | Description | UniProt 
    4451 A | T4 LYSOZYME | LYS_BPT4 1-164 
    4452  
    4453 Deleted 11 C-terminal residues, 2 N-terminal residues, 70 non-polymer residues
    4454 more than 3.0 Angstroms away. 
    4455 Alignment of 3lzm chain A to query has RMSD 1.05 using 50 of 125 paired
    4456 residues within cutoff distance 2.0 
    4457 3c7w title: 
    4458 Contributions of all 20 amino acids at site 96 to the stability and structure
    4459 of T4 lysozyme [more info...] 
    4460  
    4461 Chain information for 3c7w #196 
    4462 --- 
    4463 Chain | Description | UniProt 
    4464 A | Lysozyme | LYS_BPT4 1-164 
    4465  
    4466 Non-standard residues in 3c7w #196 
    4467 --- 
    4468 BME — β-mercaptoethanol 
    4469 CL — chloride ion 
    4470  
    4471 25 atoms have alternate locations. Control/examine alternate locations with
    4472 Altloc Explorer [start tool...] or the altlocs command. 
    4473 Deleted 11 C-terminal residues, 2 N-terminal residues, 36 non-polymer residues
    4474 more than 3.0 Angstroms away. 
    4475 Alignment of 3c7w chain A to query has RMSD 0.989 using 48 of 124 paired
    4476 residues within cutoff distance 2.0 
    4477 1p3n title: 
    4478 Core redesign back-revertant I103V/CORE10 [more info...] 
    4479  
    4480 Chain information for 1p3n #197 
    4481 --- 
    4482 Chain | Description | UniProt 
    4483 A | LYSOZYME | LYS_BPT4 1-164 
    4484  
    4485 Non-standard residues in 1p3n #197 
    4486 --- 
    4487 CL — chloride ion 
    4488 HED — 2-hydroxyethyl disulfide 
    4489 K — potassium ion 
    4490 PO4 — phosphate ion 
    4491  
    4492 16 atoms have alternate locations. Control/examine alternate locations with
    4493 Altloc Explorer [start tool...] or the altlocs command. 
    4494 Deleted 11 C-terminal residues, 2 N-terminal residues, 99 non-polymer residues
    4495 more than 3.0 Angstroms away. 
    4496 Alignment of 1p3n chain A to query has RMSD 0.991 using 48 of 127 paired
    4497 residues within cutoff distance 2.0 
    4498 1l83 title: 
    4499 A cavity-containing mutant of T4 lysozyme is stabilized by buried benzene
    4500 [more info...] 
    4501  
    4502 Chain information for 1l83 #198 
    4503 --- 
    4504 Chain | Description | UniProt 
    4505 A | T4 LYSOZYME | LYCV_BPT4 1-164 
    4506  
    4507 Non-standard residues in 1l83 #198 
    4508 --- 
    4509 BME — β-mercaptoethanol 
    4510 BNZ — benzene 
    4511 CL — chloride ion 
    4512  
    4513 Deleted 9 C-terminal residues, 2 N-terminal residues, 56 non-polymer residues
    4514 more than 3.0 Angstroms away. 
    4515 Alignment of 1l83 chain A to query has RMSD 0.952 using 47 of 127 paired
    4516 residues within cutoff distance 2.0 
    4517 1l47 title: 
    4518 Cumulative site-directed charge-change replacements In bacteriophage T4
    4519 lysozyme suggest that long-range electrostatic interactions contribute little
    4520 to protein stability [more info...] 
    4521  
    4522 Chain information for 1l47 #199 
    4523 --- 
    4524 Chain | Description | UniProt 
    4525 A | T4 LYSOZYME | LYS_BPT4 1-164 
    4526  
    4527 Deleted 10 C-terminal residues, 2 N-terminal residues, 72 non-polymer residues
    4528 more than 3.0 Angstroms away. 
    4529 Alignment of 1l47 chain A to query has RMSD 1 using 49 of 126 paired residues
    4530 within cutoff distance 2.0 
    4531 1l17 title: 
    4532 Hydrophobic stabilization In T4 lysozyme determined directly by multiple
    4533 substitutions of ile 3 [more info...] 
    4534  
    4535 Chain information for 1l17 #200 
    4536 --- 
    4537 Chain | Description | UniProt 
    4538 A | T4 LYSOZYME | LYS_BPT4 1-164 
    4539  
    4540 Deleted 11 C-terminal residues, 2 N-terminal residues, 72 non-polymer residues
    4541 more than 3.0 Angstroms away. 
    4542 Alignment of 1l17 chain A to query has RMSD 0.985 using 48 of 125 paired
    4543 residues within cutoff distance 2.0 
    4544 Fetching compressed mmCIF 1l16 from http://files.rcsb.org/download/1l16.cif 
    4545 1l16 title: 
    4546 Structural analysis of the temperature-sensitive mutant of bacteriophage T4
    4547 lysozyme, glycine 156 (right arrow) aspartic acid [more info...] 
    4548  
    4549 Chain information for 1l16 #201 
    4550 --- 
    4551 Chain | Description | UniProt 
    4552 A | T4 LYSOZYME | LYS_BPT4 1-164 
    4553  
    4554 Deleted 11 C-terminal residues, 2 N-terminal residues, 58 non-polymer residues
    4555 more than 3.0 Angstroms away. 
    4556 Alignment of 1l16 chain A to query has RMSD 1.04 using 50 of 125 paired
    4557 residues within cutoff distance 2.0 
    4558 1l13 title: 
    4559 Contributions of hydrogen bonds of THR 157 to the thermodynamic stability of
    4560 phage T4 lysozyme [more info...] 
    4561  
    4562 Chain information for 1l13 #202 
    4563 --- 
    4564 Chain | Description | UniProt 
    4565 A | T4 LYSOZYME | LYS_BPT4 1-164 
    4566  
    4567 Deleted 11 C-terminal residues, 2 N-terminal residues, 54 non-polymer residues
    4568 more than 3.0 Angstroms away. 
    4569 Alignment of 1l13 chain A to query has RMSD 1.03 using 49 of 125 paired
    4570 residues within cutoff distance 2.0 
    4571 1l11 title: 
    4572 Contributions of hydrogen bonds of THR 157 to the thermodynamic stability of
    4573 phage T4 lysozyme [more info...] 
    4574  
    4575 Chain information for 1l11 #203 
    4576 --- 
    4577 Chain | Description | UniProt 
    4578 A | T4 LYSOZYME | LYS_BPT4 1-164 
    4579  
    4580 Non-standard residues in 1l11 #203 
    4581 --- 
    4582 BME — β-mercaptoethanol 
    4583  
    4584 Deleted 11 C-terminal residues, 2 N-terminal residues, 60 non-polymer residues
    4585 more than 3.0 Angstroms away. 
    4586 Alignment of 1l11 chain A to query has RMSD 1.02 using 48 of 125 paired
    4587 residues within cutoff distance 2.0 
    4588 1l06 title: 
    4589 Contributions of hydrogen bonds of THR 157 to the thermodynamic stability of
    4590 phage T4 lysozyme [more info...] 
    4591  
    4592 Chain information for 1l06 #204 
    4593 --- 
    4594 Chain | Description | UniProt 
    4595 A | T4 LYSOZYME | LYS_BPT4 1-164 
    4596  
    4597 Deleted 11 C-terminal residues, 2 N-terminal residues, 56 non-polymer residues
    4598 more than 3.0 Angstroms away. 
    4599 Alignment of 1l06 chain A to query has RMSD 1.03 using 49 of 124 paired
    4600 residues within cutoff distance 2.0 
    4601 1ky0 title: 
    4602 Methionine core mutant of T4 lysozyme [more info...] 
    4603  
    4604 Chain information for 1ky0 #205 
    4605 --- 
    4606 Chain | Description | UniProt 
    4607 A | LYSOZYME | LYS_BPT4 1-162 
    4608  
    4609 Non-standard residues in 1ky0 #205 
    4610 --- 
    4611 CL — chloride ion 
    4612 HED — 2-hydroxyethyl disulfide 
    4613  
    4614 Deleted 9 C-terminal residues, 2 N-terminal residues, 52 non-polymer residues
    4615 more than 3.0 Angstroms away. 
    4616 Alignment of 1ky0 chain A to query has RMSD 1.01 using 51 of 126 paired
    4617 residues within cutoff distance 2.0 
    4618 1c6a title: 
    4619 T4 lysozyme mutant C54T/C97A/L133A In the presence of 8 atm krypton [more
    4620 info...] 
    4621  
    4622 Chain information for 1c6a #206 
    4623 --- 
    4624 Chain | Description | UniProt 
    4625 A | PROTEIN (LYSOZYME) | LYS_BPT4 1-164 
    4626  
    4627 Non-standard residues in 1c6a #206 
    4628 --- 
    4629 BME — β-mercaptoethanol 
    4630 CL — chloride ion 
    4631 KR — krypton 
    4632  
    4633 Deleted 9 C-terminal residues, 2 N-terminal residues, 68 non-polymer residues
    4634 more than 3.0 Angstroms away. 
    4635 Alignment of 1c6a chain A to query has RMSD 1.05 using 49 of 125 paired
    4636 residues within cutoff distance 2.0 
    4637 158l title: 
    4638 Control of enzyme activity by an engineered disulfide bond [more info...] 
    4639  
    4640 Chain information for 158l #207 
    4641 --- 
    4642 Chain | Description | UniProt 
    4643 A | T4 LYSOZYME | LYCV_BPT4 1-164 
    4644  
    4645 Non-standard residues in 158l #207 
    4646 --- 
    4647 BME — β-mercaptoethanol 
    4648 CL — chloride ion 
    4649  
    4650 Deleted 9 C-terminal residues, 2 N-terminal residues, 59 non-polymer residues
    4651 more than 3.0 Angstroms away. 
    4652 Alignment of 158l chain A to query has RMSD 1.03 using 49 of 125 paired
    4653 residues within cutoff distance 2.0 
    4654 126l title: 
    4655 The energetic cost and the structural consequences of burying A hydroxyl group
    4656 within the core of A protein determined from ala to ser and val to THR
    4657 substitutions In T4 lysozyme [more info...] 
    4658  
    4659 Chain information for 126l #208 
    4660 --- 
    4661 Chain | Description | UniProt 
    4662 A | T4 LYSOZYME | LYCV_BPT4 1-164 
    4663  
    4664 Non-standard residues in 126l #208 
    4665 --- 
    4666 BME — β-mercaptoethanol 
    4667 CL — chloride ion 
    4668  
    4669 Deleted 9 C-terminal residues, 2 N-terminal residues, 62 non-polymer residues
    4670 more than 3.0 Angstroms away. 
    4671 Alignment of 126l chain A to query has RMSD 1.03 using 49 of 125 paired
    4672 residues within cutoff distance 2.0 
    4673 120l title: 
    4674 The energetic cost and the structural consequences of burying A hydroxyl group
    4675 within the core of A protein determined from ala to ser and val to THR
    4676 substitutions In T4 lysozyme [more info...] 
    4677  
    4678 Chain information for 120l #209 
    4679 --- 
    4680 Chain | Description | UniProt 
    4681 A | T4 LYSOZYME | LYCV_BPT4 1-164 
    4682  
    4683 Non-standard residues in 120l #209 
    4684 --- 
    4685 BME — β-mercaptoethanol 
    4686 CL — chloride ion 
    4687  
    4688 Deleted 9 C-terminal residues, 2 N-terminal residues, 84 non-polymer residues
    4689 more than 3.0 Angstroms away. 
    4690 Alignment of 120l chain A to query has RMSD 1.03 using 50 of 125 paired
    4691 residues within cutoff distance 2.0 
    4692 118l title: 
    4693 The energetic cost and the structural consequences of burying A hydroxyl group
    4694 within the core of A protein determined from ala to ser and val to THR
    4695 substitutions In T4 lysozyme [more info...] 
    4696  
    4697 Chain information for 118l #210 
    4698 --- 
    4699 Chain | Description | UniProt 
    4700 A | T4 LYSOZYME | LYCV_BPT4 1-164 
    4701  
    4702 Non-standard residues in 118l #210 
    4703 --- 
    4704 BME — β-mercaptoethanol 
    4705 CL — chloride ion 
    4706  
    4707 Deleted 9 C-terminal residues, 2 N-terminal residues, 72 non-polymer residues
    4708 more than 3.0 Angstroms away. 
    4709 Alignment of 118l chain A to query has RMSD 0.996 using 48 of 125 paired
    4710 residues within cutoff distance 2.0 
    4711 Fetching compressed mmCIF 8jwz from http://files.rcsb.org/download/8jwz.cif 
    4712 Fetching CCD U30 from
    4713 https://files.wwpdb.org/pub/pdb/refdata/chem_comp/0/U30/U30.cif 
    4714 8jwz title: 
    4715 Crystal structure of A2AR-T4L in complex with AB928 [more info...] 
    4716  
    4717 Chain information for 8jwz #211 
    4718 --- 
    4719 Chain | Description | UniProt 
    4720 A | Adenosine receptor A2a,Endolysin | AA2AR_HUMAN 2-208 369-463, D9IEF7_BPT4 209-368 
    4721  
    4722 Non-standard residues in 8jwz #211 
    4723 --- 
    4724 CLR — cholesterol 
    4725 NA — sodium ion 
    4726 OLA — oleic acid 
    4727 OLC — (2R)-2,3-dihydroxypropyl (9Z)-octadec-9-enoate (1-Oleoyl-R-glycerol) 
    4728 PEG — di(hydroxyethyl)ether 
    4729 U30 —
    4730 3-[2-azanyl-6-[1-[[6-(2-oxidanylpropan-2-yl)pyridin-2-yl]methyl]-1,2,3-triazol-4-yl]pyrimidin-4-yl]-2-methyl-
    4731 benzenecarbonitrile 
    4732  
    4733 Deleted 97 C-terminal residues, 202 N-terminal residues, 254 non-polymer
    4734 residues more than 3.0 Angstroms away. 
    4735 Alignment of 8jwz chain A to query has RMSD 1.09 using 58 of 126 paired
    4736 residues within cutoff distance 2.0 
    4737 Fetching compressed mmCIF 5dgy from http://files.rcsb.org/download/5dgy.cif 
    4738 5dgy title: 
    4739 Crystal structure of rhodopsin bound to visual arrestin [more info...] 
    4740  
    4741 Chain information for 5dgy #212 
    4742 --- 
    4743 Chain | Description | UniProt 
    4744 A B C D | Endolysin,Rhodopsin,S-arrestin | ENLYS_BPT4 -159-0, OPSD_HUMAN 1-994, ARRS_MOUSE 1010-1392 
    4745  
    4746 5dgy mmCIF Assemblies 
    4747 --- 
    4748 1| author_defined_assembly 
    4749 2| author_defined_assembly 
    4750  
    4751 24665 atoms have anisotropic B-factors. Depict anisotropic information with
    4752 Thermal Ellipsoids [start tool...] or the aniso command. 
    4753 Deleted 3 extra chains, 681 C-terminal residues, 1 N-terminal residues. 
    4754 Alignment of 5dgy chain A to query has RMSD 1.23 using 61 of 125 paired
    4755 residues within cutoff distance 2.0 
    4756 3hwl title: 
    4757 Crystal Structure of T4 lysozyme with the unnatural amino acid p-Acetyl-L-
    4758 Phenylalanine incorporated at position 131 [more info...] 
    4759  
    4760 Chain information for 3hwl #213 
    4761 --- 
    4762 Chain | Description | UniProt 
    4763 A | Lysozyme | LYS_BPT4 1-164 
    4764  
    4765 Non-standard residues in 3hwl #213 
    4766 --- 
    4767 AZI — azide ion 
    4768 CL — chloride ion 
    4769  
    4770 3hwl mmCIF Assemblies 
    4771 --- 
    4772 1| software_defined_assembly 
    4773  
    4774 6 atoms have alternate locations. Control/examine alternate locations with
    4775 Altloc Explorer [start tool...] or the altlocs command. 
    4776 1431 atoms have anisotropic B-factors. Depict anisotropic information with
    4777 Thermal Ellipsoids [start tool...] or the aniso command. 
    4778 
    4779 Hit structure sequence 3hwl_A amino acid F at sequence position 130 does not
    4780 match sequence alignment N at position 128. Structure sequence
    4781 MNIFEMLRIDEGLRLKIYKDTEGYYTIGIGHLLTKSPSLNAAKSELDKAIGRNTNGVITKDEAEKLFCQDVDAAVRGILRNAKLKPVYDSLDCVRRAALINMVFQMGETGVAGFTNSLRMLQQKRWDEAAFNLAKSRWYNQTPNRAKRVITTFRTGTWDAYKNL.
    4782 Alignment sequence
    4783 IFEMLRIDEGLRLKIYKDTEGYYTIGIGHLLTKSPSLNAAKSELDKAIGRNTNGVITKDEAEKLFCQDVDAAVRGILRNAKLKPVYDSLDCVRRAALINMVFQMGETGVAGFTNSLRMLQQKRWDEAANLAKSRWYNQTPNRAKRVITTF. 
    4784 
    4785 Deleted 10 C-terminal residues, 2 N-terminal residues, 56 non-polymer residues
    4786 more than 3.0 Angstroms away. 
    4787 Alignment of 3hwl chain A to query has RMSD 0.82 using 37 of 125 paired
    4788 residues within cutoff distance 2.0 
    4789 239l title: 
    4790 The response of T4 lysozyme to large-to-small substitutions within the core
    4791 and its relation to the hydrophobic effect [more info...] 
    4792  
    4793 Chain information for 239l #214 
    4794 --- 
    4795 Chain | Description | UniProt 
    4796 A | T4 LYSOZYME | LYS_BPT4 1-164 
    4797  
    4798 Non-standard residues in 239l #214 
    4799 --- 
    4800 CL — chloride ion 
    4801  
    4802 Deleted 9 C-terminal residues, 2 N-terminal residues, 66 non-polymer residues
    4803 more than 3.0 Angstroms away. 
    4804 Alignment of 239l chain A to query has RMSD 0.956 using 47 of 126 paired
    4805 residues within cutoff distance 2.0 
    4806 229l title: 
    4807 Generating ligand binding sites In T4 lysozyme using deficiency-creating
    4808 substitutions [more info...] 
    4809  
    4810 Chain information for 229l #215 
    4811 --- 
    4812 Chain | Description | UniProt 
    4813 A | T4 LYSOZYME | LYCV_BPT4 1-164 
    4814  
    4815 Non-standard residues in 229l #215 
    4816 --- 
    4817 BME — β-mercaptoethanol 
    4818 CL — chloride ion 
    4819 GAI — guanidine 
    4820  
    4821 Deleted 9 C-terminal residues, 2 N-terminal residues, 64 non-polymer residues
    4822 more than 3.0 Angstroms away. 
    4823 Alignment of 229l chain A to query has RMSD 1.03 using 51 of 125 paired
    4824 residues within cutoff distance 2.0 
    4825 211l title: 
    4826 Protein structure plasticity exemplified by insertion and deletion mutants In
    4827 T4 lysozyme [more info...] 
    4828  
    4829 Chain information for 211l #216 
    4830 --- 
    4831 Chain | Description | UniProt 
    4832 A | T4 LYSOZYME | LYS_BPT4 1-164 
    4833  
    4834 Non-standard residues in 211l #216 
    4835 --- 
    4836 HED — 2-hydroxyethyl disulfide 
    4837  
    4838 Deleted 9 C-terminal residues, 2 N-terminal residues, 66 non-polymer residues
    4839 more than 3.0 Angstroms away. 
    4840 Alignment of 211l chain A to query has RMSD 0.989 using 47 of 125 paired
    4841 residues within cutoff distance 2.0 
    4842 1qtb title: 
    4843 The introduction of strain and its effects on the structure and stability of
    4844 T4 lysozyme [more info...] 
    4845  
    4846 Chain information for 1qtb #217 
    4847 --- 
    4848 Chain | Description | UniProt 
    4849 A | LYSOZYME | LYS_BPT4 1-162 
    4850  
    4851 Non-standard residues in 1qtb #217 
    4852 --- 
    4853 HED — 2-hydroxyethyl disulfide 
    4854  
    4855 Deleted 9 C-terminal residues, 2 N-terminal residues, 57 non-polymer residues
    4856 more than 3.0 Angstroms away. 
    4857 Alignment of 1qtb chain A to query has RMSD 1.02 using 49 of 126 paired
    4858 residues within cutoff distance 2.0 
    4859 1pqo title: 
    4860 T4 Lysozyme Core Repacking Mutant L118I/TA [more info...] 
    4861  
    4862 Chain information for 1pqo #218 
    4863 --- 
    4864 Chain | Description | UniProt 
    4865 A | Lysozyme | LYS_BPT4 1-164 
    4866  
    4867 Non-standard residues in 1pqo #218 
    4868 --- 
    4869 CL — chloride ion 
    4870 HED — 2-hydroxyethyl disulfide 
    4871 K — potassium ion 
    4872  
    4873 10 atoms have alternate locations. Control/examine alternate locations with
    4874 Altloc Explorer [start tool...] or the altlocs command. 
    4875 Deleted 11 C-terminal residues, 2 N-terminal residues, 52 non-polymer residues
    4876 more than 3.0 Angstroms away. 
    4877 Alignment of 1pqo chain A to query has RMSD 0.949 using 48 of 127 paired
    4878 residues within cutoff distance 2.0 
    4879 1l44 title: 
    4880 Cumulative site-directed charge-change replacements In bacteriophage T4
    4881 lysozyme suggest that long-range electrostatic interactions contribute little
    4882 to protein stability [more info...] 
    4883  
    4884 Chain information for 1l44 #219 
    4885 --- 
    4886 Chain | Description | UniProt 
    4887 A | T4 LYSOZYME | LYS_BPT4 1-164 
    4888  
    4889 Deleted 11 C-terminal residues, 2 N-terminal residues, 72 non-polymer residues
    4890 more than 3.0 Angstroms away. 
    4891 Alignment of 1l44 chain A to query has RMSD 0.943 using 46 of 125 paired
    4892 residues within cutoff distance 2.0 
    4893 1l28 title: 
    4894 Replacements of PRO86 In phage T4 lysozyme extend an α-helix but do not alter
    4895 protein stability [more info...] 
    4896  
    4897 Chain information for 1l28 #220 
    4898 --- 
    4899 Chain | Description | UniProt 
    4900 A | T4 LYSOZYME | LYS_BPT4 1-164 
    4901  
    4902 Deleted 11 C-terminal residues, 2 N-terminal residues, 75 non-polymer residues
    4903 more than 3.0 Angstroms away. 
    4904 Alignment of 1l28 chain A to query has RMSD 1.06 using 50 of 127 paired
    4905 residues within cutoff distance 2.0 
    4906 1l02 title: 
    4907 Contributions of hydrogen bonds of THR 157 to the thermodynamic stability of
    4908 phage T4 lysozyme [more info...] 
    4909  
    4910 Chain information for 1l02 #221 
    4911 --- 
    4912 Chain | Description | UniProt 
    4913 A | T4 LYSOZYME | LYS_BPT4 1-164 
    4914  
    4915 Deleted 11 C-terminal residues, 2 N-terminal residues, 58 non-polymer residues
    4916 more than 3.0 Angstroms away. 
    4917 Alignment of 1l02 chain A to query has RMSD 1.04 using 50 of 127 paired
    4918 residues within cutoff distance 2.0 
    4919 Fetching compressed mmCIF 1l00 from http://files.rcsb.org/download/1l00.cif 
    4920 1l00 title: 
    4921 Perturbation of TRP 138 In T4 lysozyme by mutations At GLN 105 used to
    4922 correlate changes In structure, stability, solvation, and spectroscopic
    4923 properties [more info...] 
    4924  
    4925 Chain information for 1l00 #222 
    4926 --- 
    4927 Chain | Description | UniProt 
    4928 A | T4 LYSOZYME | LYS_BPT4 1-164 
    4929  
    4930 Non-standard residues in 1l00 #222 
    4931 --- 
    4932 BME — β-mercaptoethanol 
    4933  
    4934 Deleted 9 C-terminal residues, 2 N-terminal residues, 78 non-polymer residues
    4935 more than 3.0 Angstroms away. 
    4936 Alignment of 1l00 chain A to query has RMSD 0.995 using 46 of 127 paired
    4937 residues within cutoff distance 2.0 
    4938 1g07 title: 
    4939 Crystal structure of T4 lysozyme mutant V149C [more info...] 
    4940  
    4941 Chain information for 1g07 #223 
    4942 --- 
    4943 Chain | Description | UniProt 
    4944 A | PROTEIN (LYSOZYME) | LYS_BPT4 1-164 
    4945  
    4946 Non-standard residues in 1g07 #223 
    4947 --- 
    4948 CL — chloride ion 
    4949 HED — 2-hydroxyethyl disulfide 
    4950  
    4951 1 atoms have alternate locations. Control/examine alternate locations with
    4952 Altloc Explorer [start tool...] or the altlocs command. 
    4953 Deleted 9 C-terminal residues, 2 N-terminal residues, 69 non-polymer residues
    4954 more than 3.0 Angstroms away. 
    4955 Alignment of 1g07 chain A to query has RMSD 1.01 using 49 of 125 paired
    4956 residues within cutoff distance 2.0 
    4957 199l title: 
    4958 Thermodynamic and structural compensation In "size-switch" core-repacking
    4959 variants of T4 lysozyme [more info...] 
    4960  
    4961 Chain information for 199l #224 
    4962 --- 
    4963 Chain | Description | UniProt 
    4964 A | LYSOZYME | LYCV_BPT4 1-164 
    4965  
    4966 Non-standard residues in 199l #224 
    4967 --- 
    4968 BME — β-mercaptoethanol 
    4969 CL — chloride ion 
    4970  
    4971 Deleted 9 C-terminal residues, 2 N-terminal residues, 77 non-polymer residues
    4972 more than 3.0 Angstroms away. 
    4973 Alignment of 199l chain A to query has RMSD 1.03 using 51 of 124 paired
    4974 residues within cutoff distance 2.0 
    4975 195l title: 
    4976 Thermodynamic and structural compensation In "size-switch" core-repacking
    4977 variants of T4 lysozyme [more info...] 
    4978  
    4979 Chain information for 195l #225 
    4980 --- 
    4981 Chain | Description | UniProt 
    4982 A | LYSOZYME | LYCV_BPT4 1-164 
    4983  
    4984 Non-standard residues in 195l #225 
    4985 --- 
    4986 BME — β-mercaptoethanol 
    4987 CL — chloride ion 
    4988  
    4989 Deleted 9 C-terminal residues, 2 N-terminal residues, 62 non-polymer residues
    4990 more than 3.0 Angstroms away. 
    4991 Alignment of 195l chain A to query has RMSD 0.95 using 48 of 127 paired
    4992 residues within cutoff distance 2.0 
    4993 7p41 title: 
    4994 Crystal Structure of human mARC1 A165T Variant [more info...] 
    4995  
    4996 Chain information for 7p41 #226 
    4997 --- 
    4998 Chain | Description | UniProt 
    4999 D | Mitochondrial amidoxime-reducing component 1,Endolysin,Mitochondrial amidoxime-reducing component 1 | MARC1_HUMAN 53-128 288-495, D9IEF7_BPT4 129-287 
    5000  
    5001 Non-standard residues in 7p41 #226 
    5002 --- 
    5003 B3P — 2-[3-(2-hydroxy-1,1-dihydroxymethyl-
    5004 ethylamino)-propylamino]-2-hydroxymethyl-propane-1,3-diol 
    5005 CL — chloride ion 
    5006 EFK — oxidanyl(oxidanylidene)molybdenum 
    5007 MTE — phosphonic
    5008 acidmono-(2-amino-5,6-dimercapto-4-oxo-3,7,8A,9,10,10A-hexahydro-4H-8-oxa-1,3,9,10-tetraaza-
    5009 anthracen-7-ylmethyl)ester 
    5010  
    5011 63 atoms have alternate locations. Control/examine alternate locations with
    5012 Altloc Explorer [start tool...] or the altlocs command. 
    5013 Deleted 214 C-terminal residues, 79 N-terminal residues, 402 non-polymer
    5014 residues more than 3.0 Angstroms away. 
    5015 Alignment of 7p41 chain D to query has RMSD 0.947 using 48 of 125 paired
    5016 residues within cutoff distance 2.0 
    5017 7lxa title: 
    5018 T4 lysozyme mutant L99A [more info...] 
    5019  
    5020 Chain information for 7lxa #227 
    5021 --- 
    5022 Chain | Description | UniProt 
    5023 A | Lysozyme | D9IEF7_BPT4 1-164 
    5024  
    5025 Non-standard residues in 7lxa #227 
    5026 --- 
    5027 BME — β-mercaptoethanol 
    5028 TRS — 2-amino-2-hydroxymethyl-propane-1,3-diol (tris buffer) 
    5029 YGS — (2-methylprop-2-en-1-yl)benzene 
    5030  
    5031 9 atoms have alternate locations. Control/examine alternate locations with
    5032 Altloc Explorer [start tool...] or the altlocs command. 
    5033 Deleted 9 C-terminal residues, 1 N-terminal residues, 34 non-polymer residues
    5034 more than 3.0 Angstroms away. 
    5035 Alignment of 7lxa chain A to query has RMSD 0.922 using 44 of 122 paired
    5036 residues within cutoff distance 2.0 
    5037 Fetching compressed mmCIF 6luq from http://files.rcsb.org/download/6luq.cif 
    5038 Fetching CCD GMJ from
    5039 https://files.wwpdb.org/pub/pdb/refdata/chem_comp/J/GMJ/GMJ.cif 
    5040 6luq title: 
    5041 Haloperidol bound D2 dopamine receptor structure inspired discovery of subtype
    5042 selective ligands [more info...] 
    5043  
    5044 Chain information for 6luq #228 
    5045 --- 
    5046 Chain | Description | UniProt 
    5047 A | chimera of D(2) dopamine receptor and Endolysin | DRD2_HUMAN 35-222 388-464, D9IEF7_BPT4 
    5048  
    5049 Non-standard residues in 6luq #228 
    5050 --- 
    5051 GMJ —
    5052 4-[4-(4-chlorophenyl)-4-hydroxypiperidin-1-yl]-1-(4-fluorophenyl)butan-1-one 
    5053 OLA — oleic acid 
    5054  
    5055 Deleted 85 C-terminal residues, 184 N-terminal residues, 12 non-polymer
    5056 residues more than 3.0 Angstroms away. 
    5057 Alignment of 6luq chain A to query has RMSD 1.03 using 54 of 126 paired
    5058 residues within cutoff distance 2.0 
    5059 Fetching compressed mmCIF 3sb5 from http://files.rcsb.org/download/3sb5.cif 
    5060 3sb5 title: 
    5061 Zn-mediated Trimer of T4 Lysozyme R125C/E128C by Synthetic Symmetrization
    5062 [more info...] 
    5063  
    5064 Chain information for 3sb5 #229 
    5065 --- 
    5066 Chain | Description | UniProt 
    5067 A B C D | Lysozyme | LYS_BPT4 1-162 
    5068  
    5069 Non-standard residues in 3sb5 #229 
    5070 --- 
    5071 CL — chloride ion 
    5072 GOL — glycerol (glycerin; propane-1,2,3-triol) 
    5073 MG — magnesium ion 
    5074 ZN — zinc ion 
    5075  
    5076 3sb5 mmCIF Assemblies 
    5077 --- 
    5078 1| author_and_software_defined_assembly 
    5079 2| author_and_software_defined_assembly 
    5080 3| author_and_software_defined_assembly 
    5081 4| author_and_software_defined_assembly 
    5082  
    5083 8 atoms have alternate locations. Control/examine alternate locations with
    5084 Altloc Explorer [start tool...] or the altlocs command. 
    5085 5326 atoms have anisotropic B-factors. Depict anisotropic information with
    5086 Thermal Ellipsoids [start tool...] or the aniso command. 
    5087 Deleted 3 extra chains, 9 C-terminal residues, 4 N-terminal residues, 191 non-
    5088 polymer residues more than 3.0 Angstroms away. 
    5089 Alignment of 3sb5 chain A to query has RMSD 1.17 using 68 of 125 paired
    5090 residues within cutoff distance 2.0 
    5091 3jr6 title: 
    5092 Sequential reorganization of beta-sheet topology by insertion of a single
    5093 strand [more info...] 
    5094  
    5095 Chain information for 3jr6 #230 
    5096 --- 
    5097 Chain | Description | UniProt 
    5098 A B C D | Lysozyme | LYS_BPT4 1-170 
    5099  
    5100 Non-standard residues in 3jr6 #230 
    5101 --- 
    5102 SO4 — sulfate ion 
    5103  
    5104 3jr6 mmCIF Assemblies 
    5105 --- 
    5106 1| author_defined_assembly 
    5107 2| author_defined_assembly 
    5108 3| author_defined_assembly 
    5109 4| author_defined_assembly 
    5110  
    5111 Deleted 3 extra chains, 10 C-terminal residues, 2 N-terminal residues, 6 non-
    5112 polymer residues more than 3.0 Angstroms away. 
    5113 Alignment of 3jr6 chain B to query has RMSD 1.16 using 60 of 123 paired
    5114 residues within cutoff distance 2.0 
    5115 3cdr title: 
    5116 R96Q Mutant of wildtype phage T4 lysozyme at 298 K [more info...] 
    5117  
    5118 Chain information for 3cdr #231 
    5119 --- 
    5120 Chain | Description | UniProt 
    5121 A | Lysozyme | LYS_BPT4 1-164 
    5122  
    5123 Non-standard residues in 3cdr #231 
    5124 --- 
    5125 CL — chloride ion 
    5126 HED — 2-hydroxyethyl disulfide 
    5127  
    5128 31 atoms have alternate locations. Control/examine alternate locations with
    5129 Altloc Explorer [start tool...] or the altlocs command. 
    5130 Deleted 11 C-terminal residues, 2 N-terminal residues, 40 non-polymer residues
    5131 more than 3.0 Angstroms away. 
    5132 Alignment of 3cdr chain A to query has RMSD 0.992 using 48 of 125 paired
    5133 residues within cutoff distance 2.0 
    5134 3c8q title: 
    5135 Contribution of all 20 amino acids at site 96 to the stability and structure
    5136 of T4 lysozyme [more info...] 
    5137  
    5138 Chain information for 3c8q #232 
    5139 --- 
    5140 Chain | Description | UniProt 
    5141 A | Lysozyme | LYS_BPT4 1-164 
    5142  
    5143 Non-standard residues in 3c8q #232 
    5144 --- 
    5145 BME — β-mercaptoethanol 
    5146 CL — chloride ion 
    5147 K — potassium ion 
    5148  
    5149 41 atoms have alternate locations. Control/examine alternate locations with
    5150 Altloc Explorer [start tool...] or the altlocs command. 
    5151 Deleted 11 C-terminal residues, 2 N-terminal residues, 29 non-polymer residues
    5152 more than 3.0 Angstroms away. 
    5153 Alignment of 3c8q chain A to query has RMSD 0.954 using 47 of 125 paired
    5154 residues within cutoff distance 2.0 
    5155 233l title: 
    5156 T4 lysozyme mutant M120L [more info...] 
    5157  
    5158 Chain information for 233l #233 
    5159 --- 
    5160 Chain | Description | UniProt 
    5161 A | T4 LYSOZYME | LYS_BPT4 1-164 
    5162  
    5163 Non-standard residues in 233l #233 
    5164 --- 
    5165 BME — β-mercaptoethanol 
    5166 CL — chloride ion 
    5167  
    5168 Deleted 9 C-terminal residues, 2 N-terminal residues, 65 non-polymer residues
    5169 more than 3.0 Angstroms away. 
    5170 Alignment of 233l chain A to query has RMSD 0.947 using 46 of 125 paired
    5171 residues within cutoff distance 2.0 
    5172 1ov7 title: 
    5173 T4 Lysozyme Cavity Mutant L99A/M102Q Bound with 2-Allyl-6-Methyl-Phenol [more
    5174 info...] 
    5175  
    5176 Chain information for 1ov7 #234 
    5177 --- 
    5178 Chain | Description | UniProt 
    5179 A | Lysozyme | LYS_BPT4 1-164 
    5180  
    5181 Non-standard residues in 1ov7 #234 
    5182 --- 
    5183 BME — β-mercaptoethanol 
    5184 CL — chloride ion 
    5185 LYL — 2-allyl-6-methyl-phenol 
    5186  
    5187 Deleted 9 C-terminal residues, 2 N-terminal residues, 22 non-polymer residues
    5188 more than 3.0 Angstroms away. 
    5189 Alignment of 1ov7 chain A to query has RMSD 0.956 using 46 of 125 paired
    5190 residues within cutoff distance 2.0 
    5191 1lyf title: 
    5192 Dissection of helix capping In T4 lysozyme by structural and thermodynamic
    5193 analysis of six amino acid substitutions At THR 59 [more info...] 
    5194  
    5195 Chain information for 1lyf #235 
    5196 --- 
    5197 Chain | Description | UniProt 
    5198 A | T4 LYSOZYME | LYCV_BPT4 1-164 
    5199  
    5200 Non-standard residues in 1lyf #235 
    5201 --- 
    5202 BME — β-mercaptoethanol 
    5203 CL — chloride ion 
    5204  
    5205 Deleted 7 C-terminal residues, 2 N-terminal residues, 58 non-polymer residues
    5206 more than 3.0 Angstroms away. 
    5207 Alignment of 1lyf chain A to query has RMSD 0.934 using 46 of 127 paired
    5208 residues within cutoff distance 2.0 
    5209 1l81 title: 
    5210 Design and structural analysis of alternative hydrophobic core packing
    5211 arrangements In bacteriophage T4 lysozyme [more info...] 
    5212  
    5213 Chain information for 1l81 #236 
    5214 --- 
    5215 Chain | Description | UniProt 
    5216 A | T4 LYSOZYME | LYCV_BPT4 1-164 
    5217  
    5218 Non-standard residues in 1l81 #236 
    5219 --- 
    5220 BME — β-mercaptoethanol 
    5221 CL — chloride ion 
    5222  
    5223 Deleted 9 C-terminal residues, 2 N-terminal residues, 62 non-polymer residues
    5224 more than 3.0 Angstroms away. 
    5225 Alignment of 1l81 chain A to query has RMSD 1.12 using 53 of 124 paired
    5226 residues within cutoff distance 2.0 
    5227 Fetching compressed mmCIF 1l54 from http://files.rcsb.org/download/1l54.cif 
    5228 1l54 title: 
    5229 The structural and thermodynamic consequences of burying A charged residue
    5230 within the hydrophobic core of T4 lysozyme [more info...] 
    5231  
    5232 Chain information for 1l54 #237 
    5233 --- 
    5234 Chain | Description | UniProt 
    5235 A | T4 LYSOZYME | LYS_BPT4 1-164 
    5236  
    5237 Deleted 11 C-terminal residues, 2 N-terminal residues, 68 non-polymer residues
    5238 more than 3.0 Angstroms away. 
    5239 Alignment of 1l54 chain A to query has RMSD 0.936 using 46 of 125 paired
    5240 residues within cutoff distance 2.0 
    5241 1l50 title: 
    5242 Structural and thermodynamic analysis of the packing of two α-helices In
    5243 bacteriophage T4 lysozyme [more info...] 
    5244  
    5245 Chain information for 1l50 #238 
    5246 --- 
    5247 Chain | Description | UniProt 
    5248 A | T4 LYSOZYME | LYS_BPT4 1-164 
    5249  
    5250 Deleted 11 C-terminal residues, 2 N-terminal residues, 70 non-polymer residues
    5251 more than 3.0 Angstroms away. 
    5252 Alignment of 1l50 chain A to query has RMSD 1.03 using 48 of 127 paired
    5253 residues within cutoff distance 2.0 
    5254 1l23 title: 
    5255 Enhanced protein thermostability from site-directed mutations that decrease
    5256 the entropy of unfolding [more info...] 
    5257  
    5258 Chain information for 1l23 #239 
    5259 --- 
    5260 Chain | Description | UniProt 
    5261 A | T4 LYSOZYME | LYS_BPT4 1-164 
    5262  
    5263 Deleted 11 C-terminal residues, 2 N-terminal residues, 70 non-polymer residues
    5264 more than 3.0 Angstroms away. 
    5265 Alignment of 1l23 chain A to query has RMSD 1.03 using 49 of 125 paired
    5266 residues within cutoff distance 2.0 
    5267 1l19 title: 
    5268 Enhanced protein thermostability from designed mutations that interact with
    5269 α-helix dipoles [more info...] 
    5270  
    5271 Chain information for 1l19 #240 
    5272 --- 
    5273 Chain | Description | UniProt 
    5274 A | T4 LYSOZYME | LYS_BPT4 1-164 
    5275  
    5276 Deleted 11 C-terminal residues, 2 N-terminal residues, 73 non-polymer residues
    5277 more than 3.0 Angstroms away. 
    5278 Alignment of 1l19 chain A to query has RMSD 1.04 using 49 of 125 paired
    5279 residues within cutoff distance 2.0 
    5280 1jqu title: 
    5281 Are Carboxy Terminii of Helices Coded by the Local Sequence or by Tertiary
    5282 Structure Contacts [more info...] 
    5283  
    5284 Chain information for 1jqu #241 
    5285 --- 
    5286 Chain | Description | UniProt 
    5287 A B C D | Lysozyme | LYS_BPT4 1-164 
    5288  
    5289 1jqu mmCIF Assemblies 
    5290 --- 
    5291 1| author_defined_assembly 
    5292 2| author_defined_assembly 
    5293 3| author_defined_assembly 
    5294 4| author_defined_assembly 
    5295  
    5296 Deleted 3 extra chains, 11 C-terminal residues, 2 N-terminal residues, 28 non-
    5297 polymer residues more than 3.0 Angstroms away. 
    5298 Alignment of 1jqu chain D to query has RMSD 1.24 using 52 of 121 paired
    5299 residues within cutoff distance 2.0 
    5300 1d2y title: 
    5301 N-terminal domain core methionine mutation [more info...] 
    5302  
    5303 Chain information for 1d2y #242 
    5304 --- 
    5305 Chain | Description | UniProt 
    5306 A | LYSOZYME | LYS_BPT4 1-164 
    5307  
    5308 Non-standard residues in 1d2y #242 
    5309 --- 
    5310 CL — chloride ion 
    5311 HED — 2-hydroxyethyl disulfide 
    5312  
    5313 Deleted 9 C-terminal residues, 2 N-terminal residues, 52 non-polymer residues
    5314 more than 3.0 Angstroms away. 
    5315 Alignment of 1d2y chain A to query has RMSD 0.962 using 47 of 125 paired
    5316 residues within cutoff distance 2.0 
    5317 1cu6 title: 
    5318 T4 lysozyme mutant L91A [more info...] 
    5319  
    5320 Chain information for 1cu6 #243 
    5321 --- 
    5322 Chain | Description | UniProt 
    5323 A | LYSOZYME | LYS_BPT4 1-164 
    5324  
    5325 Non-standard residues in 1cu6 #243 
    5326 --- 
    5327 CL — chloride ion 
    5328 HED — 2-hydroxyethyl disulfide 
    5329  
    5330 Deleted 9 C-terminal residues, 2 N-terminal residues, 57 non-polymer residues
    5331 more than 3.0 Angstroms away. 
    5332 Alignment of 1cu6 chain A to query has RMSD 0.97 using 47 of 127 paired
    5333 residues within cutoff distance 2.0 
    5334 Fetching compressed mmCIF 1b6i from http://files.rcsb.org/download/1b6i.cif 
    5335 1b6i title: 
    5336 T4 lysozyme mutant with cys 54 replaced by THR, cys 97 replaced by ala, THR 21
    5337 replaced by cys and lys 124 replaced by cys (C54T,C97A,T21C,K124C) [more
    5338 info...] 
    5339  
    5340 Chain information for 1b6i #244 
    5341 --- 
    5342 Chain | Description | UniProt 
    5343 A | PROTEIN (LYSOZYME) | LYS_BPT4 1-164 
    5344  
    5345 Non-standard residues in 1b6i #244 
    5346 --- 
    5347 HED — 2-hydroxyethyl disulfide 
    5348  
    5349 Deleted 9 C-terminal residues, 2 N-terminal residues, 33 non-polymer residues
    5350 more than 3.0 Angstroms away. 
    5351 Alignment of 1b6i chain A to query has RMSD 0.986 using 47 of 125 paired
    5352 residues within cutoff distance 2.0 
    5353 138l title: 
    5354 Rapid crystallization of T4 lysozyme by intermolecular disulfide crosslinking
    5355 [more info...] 
    5356  
    5357 Chain information for 138l #245 
    5358 --- 
    5359 Chain | Description | UniProt 
    5360 A | T4 LYSOZYME | LYS_BPT4 1-164 
    5361  
    5362 Non-standard residues in 138l #245 
    5363 --- 
    5364 BME — β-mercaptoethanol 
    5365 CL — chloride ion 
    5366  
    5367 Deleted 9 C-terminal residues, 2 N-terminal residues, 50 non-polymer residues
    5368 more than 3.0 Angstroms away. 
    5369 Alignment of 138l chain A to query has RMSD 0.981 using 48 of 125 paired
    5370 residues within cutoff distance 2.0 
    5371 130l title: 
    5372 Structures of randomly generated mutants of T4 lysozyme show that protein
    5373 stability can Be enhanced by relaxation of strain and by improved hydrogen
    5374 bonding via bound solvent [more info...] 
    5375  
    5376 Chain information for 130l #246 
    5377 --- 
    5378 Chain | Description | UniProt 
    5379 A | T4 LYSOZYME | LYCV_BPT4 1-164 
    5380  
    5381 Non-standard residues in 130l #246 
    5382 --- 
    5383 BME — β-mercaptoethanol 
    5384 CL — chloride ion 
    5385  
    5386 Deleted 9 C-terminal residues, 2 N-terminal residues, 87 non-polymer residues
    5387 more than 3.0 Angstroms away. 
    5388 Alignment of 130l chain A to query has RMSD 0.931 using 46 of 125 paired
    5389 residues within cutoff distance 2.0 
    5390 
    5391 Atom OE1 has no neighbors to form bonds with according to residue template for
    5392 GLN /A:-3 
    5393 
    5394 Atom NE2 has no neighbors to form bonds with according to residue template for
    5395 GLN /A:-3 
    5396 
    5397 6xom title: 
    5398 DCN1 bound to 8 [more info...] 
    5399  
    5400 Chain information for 6xom #247 
    5401 --- 
    5402 Chain | Description | UniProt 
    5403 A | Lysozyme, DCN1-like protein 1 chimera | D9IEF7_BPT4 1-164, DCNL1_HUMAN 1062-1259 
    5404  
    5405 Non-standard residues in 6xom #247 
    5406 --- 
    5407 EDO — 1,2-ethanediol (ethylene glycol) 
    5408 H8V —
    5409 (2R)-N-[(2S)-2-cyclohexyl-2-({N-propanoyl-3-[6-(propan-2-yl)-1,3-benzothiazol-2-yl]-L-alanyl}amino)ethyl]-2-methyl-4-(morpholin-4-yl)butanamide 
    5410  
    5411 14 atoms have alternate locations. Control/examine alternate locations with
    5412 Altloc Explorer [start tool...] or the altlocs command. 
    5413 2837 atoms have anisotropic B-factors. Depict anisotropic information with
    5414 Thermal Ellipsoids [start tool...] or the aniso command. 
    5415 Deleted 201 C-terminal residues, 4 N-terminal residues, 207 non-polymer
    5416 residues more than 3.0 Angstroms away. 
    5417 Alignment of 6xom chain A to query has RMSD 0.983 using 52 of 126 paired
    5418 residues within cutoff distance 2.0 
    5419 5d5a title: 
    5420 In meso in situ serial X-ray crystallography structure of the Beta2-adrenergic
    5421 receptor at 100 K [more info...] 
    5422  
    5423 Chain information for 5d5a #248 
    5424 --- 
    5425 Chain | Description | UniProt 
    5426 A | Beta-2 adrenergic receptor,Endolysin,Beta-2 adrenergic receptor | ADRB2_HUMAN 1-230 263-365, ENLYS_BPT4 1002-1161 
    5427  
    5428 Non-standard residues in 5d5a #248 
    5429 --- 
    5430 12P — dodecaethylene glycol (polyethylene glycol PEG400) 
    5431 ACM — acetamide 
    5432 BGC — beta-D-glucopyranose (beta-D-glucose; D-glucose; glucose) 
    5433 BU1 — 1,4-butanediol 
    5434 CAU — (2S)-1-(9H-Carbazol-4-yloxy)-3-(isopropylamino)propan-2-ol
    5435 ((S)-Carazolol) 
    5436 CLR — cholesterol 
    5437 GLC — alpha-D-glucopyranose (alpha-D-glucose; D-glucose; glucose) 
    5438 PLM — palmitic acid 
    5439 SO4 — sulfate ion 
    5440  
    5441 Deleted 88 C-terminal residues, 197 N-terminal residues, 35 non-polymer
    5442 residues more than 3.0 Angstroms away. 
    5443 Alignment of 5d5a chain A to query has RMSD 1.04 using 49 of 132 paired
    5444 residues within cutoff distance 2.0 
    5445 4lzm title: 
    5446 Comparison of the crystal structure of bacteriophage T4 lysozyme At low,
    5447 medium, and high ionic strengths [more info...] 
    5448  
    5449 Chain information for 4lzm #249 
    5450 --- 
    5451 Chain | Description | UniProt 
    5452 A | T4 LYSOZYME | LYS_BPT4 1-164 
    5453  
    5454 Non-standard residues in 4lzm #249 
    5455 --- 
    5456 BME — β-mercaptoethanol 
    5457 CL — chloride ion 
    5458  
    5459 Deleted 9 C-terminal residues, 2 N-terminal residues, 63 non-polymer residues
    5460 more than 3.0 Angstroms away. 
    5461 Alignment of 4lzm chain A to query has RMSD 1.02 using 49 of 125 paired
    5462 residues within cutoff distance 2.0 
    5463 3htb title: 
    5464 2-propylphenol in complex with T4 lysozyme L99A/M102Q [more info...] 
    5465  
    5466 Chain information for 3htb #250 
    5467 --- 
    5468 Chain | Description | UniProt 
    5469 A | Lysozyme | LYS_BPT4 1-164 
    5470  
    5471 Non-standard residues in 3htb #250 
    5472 --- 
    5473 BME — β-mercaptoethanol 
    5474 JZ4 — 2-propylphenol 
    5475 PO4 — phosphate ion 
    5476  
    5477 64 atoms have alternate locations. Control/examine alternate locations with
    5478 Altloc Explorer [start tool...] or the altlocs command. 
    5479 Deleted 10 C-terminal residues, 2 N-terminal residues, 97 non-polymer residues
    5480 more than 3.0 Angstroms away. 
    5481 Alignment of 3htb chain A to query has RMSD 0.981 using 47 of 123 paired
    5482 residues within cutoff distance 2.0 
    5483 1quh title: 
    5484 L99G/E108V mutant of T4 lysozyme [more info...] 
    5485  
    5486 Chain information for 1quh #251 
    5487 --- 
    5488 Chain | Description | UniProt 
    5489 A | PROTEIN (LYSOZYME) | LYS_BPT4 1-162 
    5490  
    5491 Non-standard residues in 1quh #251 
    5492 --- 
    5493 CL — chloride ion 
    5494 HEZ — hexane-1,6-diol 
    5495  
    5496 Deleted 9 C-terminal residues, 2 N-terminal residues, 46 non-polymer residues
    5497 more than 3.0 Angstroms away. 
    5498 Alignment of 1quh chain A to query has RMSD 0.994 using 49 of 127 paired
    5499 residues within cutoff distance 2.0 
    5500 1qt5 title: 
    5501 D20E mutant structure of T4 lysozyme [more info...] 
    5502  
    5503 Chain information for 1qt5 #252 
    5504 --- 
    5505 Chain | Description | UniProt 
    5506 A | PROTEIN (T4 LYSOZYME) | LYS_BPT4 1-164 
    5507  
    5508 Non-standard residues in 1qt5 #252 
    5509 --- 
    5510 HED — 2-hydroxyethyl disulfide 
    5511  
    5512 Deleted 11 C-terminal residues, 2 N-terminal residues, 77 non-polymer residues
    5513 more than 3.0 Angstroms away. 
    5514 Alignment of 1qt5 chain A to query has RMSD 1 using 48 of 125 paired residues
    5515 within cutoff distance 2.0 
    5516 1l64 title: 
    5517 Tolerance of T4 lysozyme to multiple xaa (right arrow) ala substitutions: A
    5518 polyalanine α-helix containing ten consecutive alanines [more info...] 
    5519  
    5520 Chain information for 1l64 #253 
    5521 --- 
    5522 Chain | Description | UniProt 
    5523 A | LYSOZYME | LYCV_BPT4 1-164 
    5524  
    5525 Non-standard residues in 1l64 #253 
    5526 --- 
    5527 BME — β-mercaptoethanol 
    5528 CL — chloride ion 
    5529  
    5530 Deleted 9 C-terminal residues, 2 N-terminal residues, 65 non-polymer residues
    5531 more than 3.0 Angstroms away. 
    5532 Alignment of 1l64 chain A to query has RMSD 0.937 using 46 of 124 paired
    5533 residues within cutoff distance 2.0 
    5534 1l58 title: 
    5535 Analysis of the interaction between charged side chains and the α-helix dipole
    5536 using designed thermostable mutants of phage T4 lysozyme [more info...] 
    5537  
    5538 Chain information for 1l58 #254 
    5539 --- 
    5540 Chain | Description | UniProt 
    5541 A | T4 LYSOZYME | LYS_BPT4 1-164 
    5542  
    5543 Non-standard residues in 1l58 #254 
    5544 --- 
    5545 BME — β-mercaptoethanol 
    5546  
    5547 Deleted 11 C-terminal residues, 2 N-terminal residues, 75 non-polymer residues
    5548 more than 3.0 Angstroms away. 
    5549 Alignment of 1l58 chain A to query has RMSD 0.963 using 47 of 125 paired
    5550 residues within cutoff distance 2.0 
    5551 Fetching compressed mmCIF 1l34 from http://files.rcsb.org/download/1l34.cif 
    5552 1l34 title: 
    5553 High-resolution structure of the temperature-sensitive mutant of phage
    5554 lysozyme, arg 96 (right arrow) his [more info...] 
    5555  
    5556 Chain information for 1l34 #255 
    5557 --- 
    5558 Chain | Description | UniProt 
    5559 A | T4 LYSOZYME | LYS_BPT4 1-164 
    5560  
    5561 Deleted 11 C-terminal residues, 2 N-terminal residues, 76 non-polymer residues
    5562 more than 3.0 Angstroms away. 
    5563 Alignment of 1l34 chain A to query has RMSD 1.02 using 48 of 125 paired
    5564 residues within cutoff distance 2.0 
    5565 1kw7 title: 
    5566 Methionine core mutant of T4 lysozyme [more info...] 
    5567  
    5568 Chain information for 1kw7 #256 
    5569 --- 
    5570 Chain | Description | UniProt 
    5571 A | LYSOZYME | LYS_BPT4 1-162 
    5572  
    5573 Non-standard residues in 1kw7 #256 
    5574 --- 
    5575 CL — chloride ion 
    5576 HED — 2-hydroxyethyl disulfide 
    5577  
    5578 Deleted 9 C-terminal residues, 2 N-terminal residues, 69 non-polymer residues
    5579 more than 3.0 Angstroms away. 
    5580 Alignment of 1kw7 chain A to query has RMSD 0.975 using 46 of 125 paired
    5581 residues within cutoff distance 2.0 
    5582 1cu5 title: 
    5583 T4 lysozyme mutant L91M [more info...] 
    5584  
    5585 Chain information for 1cu5 #257 
    5586 --- 
    5587 Chain | Description | UniProt 
    5588 A | LYSOZYME | LYS_BPT4 1-164 
    5589  
    5590 Non-standard residues in 1cu5 #257 
    5591 --- 
    5592 CL — chloride ion 
    5593 HED — 2-hydroxyethyl disulfide 
    5594  
    5595 Deleted 9 C-terminal residues, 2 N-terminal residues, 60 non-polymer residues
    5596 more than 3.0 Angstroms away. 
    5597 Alignment of 1cu5 chain A to query has RMSD 0.988 using 48 of 125 paired
    5598 residues within cutoff distance 2.0 
    5599 Fetching compressed mmCIF 6igl from http://files.rcsb.org/download/6igl.cif 
    5600 Fetching CCD SIN from
    5601 https://files.wwpdb.org/pub/pdb/refdata/chem_comp/N/SIN/SIN.cif 
    5602 6igl title: 
    5603 Crystal Structure of human ETB receptor in complex with IRL1620 [more info...] 
    5604  
    5605 Chain information for 6igl #258 
    5606 --- 
    5607 Chain | Description | UniProt 
    5608 A | Endothelin receptor type B,Endolysin,Endothelin receptor type B | EDNRB_HUMAN 66-303 311-407, A0A097J809_BPT4 1000-1159 
    5609 B | IRL1620 |   
    5610  
    5611 Non-standard residues in 6igl #258 
    5612 --- 
    5613 CIT — citric acid 
    5614 OLC — (2R)-2,3-dihydroxypropyl (9Z)-octadec-9-enoate (1-Oleoyl-R-glycerol) 
    5615 SIN — succinic acid 
    5616 SO4 — sulfate ion 
    5617  
    5618 8 atoms have alternate locations. Control/examine alternate locations with
    5619 Altloc Explorer [start tool...] or the altlocs command. 
    5620 Deleted 1 extra chains, 100 C-terminal residues, 215 N-terminal residues, 31
    5621 non-polymer residues more than 3.0 Angstroms away. 
    5622 Alignment of 6igl chain A to query has RMSD 1.03 using 54 of 126 paired
    5623 residues within cutoff distance 2.0 
    5624 6bg5 title: 
    5625 Structure of
    5626 1-(benzo[d][1,3]dioxol-5-ylmethyl)-1-(1-propylpiperidin-4-yl)-3-(3-(trifluoromethyl)phenyl)urea
    5627 bound to DCN1 [more info...] 
    5628  
    5629 Chain information for 6bg5 #259 
    5630 --- 
    5631 Chain | Description | UniProt 
    5632 A | Endolysin, DCN1-like protein 1 chimera | ENLYS_BPT4 1-164, DCNL1_HUMAN 1062-1259 
    5633  
    5634 Non-standard residues in 6bg5 #259 
    5635 --- 
    5636 DQD —
    5637 N-[(2H-1,3-benzodioxol-5-yl)methyl]-N-(1-propylpiperidin-4-yl)-N'-[3-(trifluoromethyl)phenyl]urea 
    5638  
    5639 158 atoms have alternate locations. Control/examine alternate locations with
    5640 Altloc Explorer [start tool...] or the altlocs command. 
    5641 3553 atoms have anisotropic B-factors. Depict anisotropic information with
    5642 Thermal Ellipsoids [start tool...] or the aniso command. 
    5643 Deleted 200 C-terminal residues, 15 N-terminal residues, 480 non-polymer
    5644 residues more than 3.0 Angstroms away. 
    5645 Alignment of 6bg5 chain A to query has RMSD 1.26 using 67 of 121 paired
    5646 residues within cutoff distance 2.0 
    5647 243l title: 
    5648 The response of T4 lysozyme to large-to-small substitutions within the core
    5649 and its relation to the hydrophobic effect [more info...] 
    5650  
    5651 Chain information for 243l #260 
    5652 --- 
    5653 Chain | Description | UniProt 
    5654 A | T4 LYSOZYME | LYS_BPT4 1-164 
    5655  
    5656 Non-standard residues in 243l #260 
    5657 --- 
    5658 CL — chloride ion 
    5659 HED — 2-hydroxyethyl disulfide 
    5660  
    5661 Deleted 9 C-terminal residues, 2 N-terminal residues, 67 non-polymer residues
    5662 more than 3.0 Angstroms away. 
    5663 Alignment of 243l chain A to query has RMSD 0.981 using 47 of 125 paired
    5664 residues within cutoff distance 2.0 
    5665 226l title: 
    5666 Generating ligand binding sites In T4 lysozyme using deficiency-creating
    5667 substitutions [more info...] 
    5668  
    5669 Chain information for 226l #261 
    5670 --- 
    5671 Chain | Description | UniProt 
    5672 A | T4 LYSOZYME | LYS_BPT4 1-164 
    5673  
    5674 Non-standard residues in 226l #261 
    5675 --- 
    5676 BME — β-mercaptoethanol 
    5677 CL — chloride ion 
    5678  
    5679 Deleted 9 C-terminal residues, 2 N-terminal residues, 59 non-polymer residues
    5680 more than 3.0 Angstroms away. 
    5681 Alignment of 226l chain A to query has RMSD 0.942 using 45 of 126 paired
    5682 residues within cutoff distance 2.0 
    5683 1qsq title: 
    5684 Cavity creating mutation [more info...] 
    5685  
    5686 Chain information for 1qsq #262 
    5687 --- 
    5688 Chain | Description | UniProt 
    5689 A | LYSOZYME | LYS_BPT4 1-164 
    5690  
    5691 Non-standard residues in 1qsq #262 
    5692 --- 
    5693 CL — chloride ion 
    5694 HED — 2-hydroxyethyl disulfide 
    5695  
    5696 Deleted 9 C-terminal residues, 2 N-terminal residues, 63 non-polymer residues
    5697 more than 3.0 Angstroms away. 
    5698 Alignment of 1qsq chain A to query has RMSD 0.989 using 48 of 125 paired
    5699 residues within cutoff distance 2.0 
    5700 1p7s title: 
    5701 T4 lysozyme core repacking mutant V103I/Ta [more info...] 
    5702  
    5703 Chain information for 1p7s #263 
    5704 --- 
    5705 Chain | Description | UniProt 
    5706 A | LYSOZYME | LYS_BPT4 1-164 
    5707  
    5708 11 atoms have alternate locations. Control/examine alternate locations with
    5709 Altloc Explorer [start tool...] or the altlocs command. 
    5710 Deleted 11 C-terminal residues, 2 N-terminal residues, 83 non-polymer residues
    5711 more than 3.0 Angstroms away. 
    5712 Alignment of 1p7s chain A to query has RMSD 1.3 using 60 of 124 paired
    5713 residues within cutoff distance 2.0 
    5714 1l98 title: 
    5715 Perturbation of TRP 138 In T4 lysozyme by mutations At GLN 105 used to
    5716 correlate changes In structure, stability, solvation, and spectroscopic
    5717 properties [more info...] 
    5718  
    5719 Chain information for 1l98 #264 
    5720 --- 
    5721 Chain | Description | UniProt 
    5722 A | T4 LYSOZYME | LYS_BPT4 1-164 
    5723  
    5724 Non-standard residues in 1l98 #264 
    5725 --- 
    5726 BME — β-mercaptoethanol 
    5727  
    5728 Deleted 11 C-terminal residues, 2 N-terminal residues, 88 non-polymer residues
    5729 more than 3.0 Angstroms away. 
    5730 Alignment of 1l98 chain A to query has RMSD 0.955 using 46 of 127 paired
    5731 residues within cutoff distance 2.0 
    5732 1l80 title: 
    5733 Design and structural analysis of alternative hydrophobic core packing
    5734 arrangements In bacteriophage T4 lysozyme [more info...] 
    5735  
    5736 Chain information for 1l80 #265 
    5737 --- 
    5738 Chain | Description | UniProt 
    5739 A | T4 LYSOZYME | LYCV_BPT4 1-164 
    5740  
    5741 Non-standard residues in 1l80 #265 
    5742 --- 
    5743 BME — β-mercaptoethanol 
    5744 CL — chloride ion 
    5745  
    5746 Deleted 9 C-terminal residues, 2 N-terminal residues, 55 non-polymer residues
    5747 more than 3.0 Angstroms away. 
    5748 Alignment of 1l80 chain A to query has RMSD 0.926 using 45 of 125 paired
    5749 residues within cutoff distance 2.0 
    5750 1l41 title: 
    5751 Contributions of engineered surface salt bridges to the stability of T4
    5752 lysozyme determined by directed mutagenesis [more info...] 
    5753  
    5754 Chain information for 1l41 #266 
    5755 --- 
    5756 Chain | Description | UniProt 
    5757 A | T4 LYSOZYME | LYS_BPT4 1-164 
    5758  
    5759 Deleted 11 C-terminal residues, 2 N-terminal residues, 69 non-polymer residues
    5760 more than 3.0 Angstroms away. 
    5761 Alignment of 1l41 chain A to query has RMSD 0.965 using 47 of 125 paired
    5762 residues within cutoff distance 2.0 
    5763 1l30 title: 
    5764 Replacements of PRO86 In phage T4 lysozyme extend an α-helix but do not alter
    5765 protein stability [more info...] 
    5766  
    5767 Chain information for 1l30 #267 
    5768 --- 
    5769 Chain | Description | UniProt 
    5770 A | T4 LYSOZYME | LYS_BPT4 1-164 
    5771  
    5772 Deleted 11 C-terminal residues, 2 N-terminal residues, 75 non-polymer residues
    5773 more than 3.0 Angstroms away. 
    5774 Alignment of 1l30 chain A to query has RMSD 1.02 using 48 of 125 paired
    5775 residues within cutoff distance 2.0 
    5776 1g1v title: 
    5777 T4 lysozyme mutant C54T/C97A/I58T [more info...] 
    5778  
    5779 Chain information for 1g1v #268 
    5780 --- 
    5781 Chain | Description | UniProt 
    5782 A | LYSOZYME | LYCV_BPT4 1-164 
    5783  
    5784 Non-standard residues in 1g1v #268 
    5785 --- 
    5786 BME — β-mercaptoethanol 
    5787 CL — chloride ion 
    5788  
    5789 Deleted 9 C-terminal residues, 2 N-terminal residues, 59 non-polymer residues
    5790 more than 3.0 Angstroms away. 
    5791 Alignment of 1g1v chain A to query has RMSD 0.909 using 45 of 125 paired
    5792 residues within cutoff distance 2.0 
    5793 191l title: 
    5794 A helix initiation signal In T4 lysozyme identified by polyalanine mutagenesis
    5795 [more info...] 
    5796  
    5797 Chain information for 191l #269 
    5798 --- 
    5799 Chain | Description | UniProt 
    5800 A | LYSOZYME | LYS_BPT4 1-164 
    5801  
    5802 Non-standard residues in 191l #269 
    5803 --- 
    5804 CL — chloride ion 
    5805 HED — 2-hydroxyethyl disulfide 
    5806  
    5807 Deleted 9 C-terminal residues, 2 N-terminal residues, 74 non-polymer residues
    5808 more than 3.0 Angstroms away. 
    5809 Alignment of 191l chain A to query has RMSD 1.05 using 49 of 127 paired
    5810 residues within cutoff distance 2.0 
    5811 190l title: 
    5812 A helix initiation signal In T4 lysozyme identified by polyalanine mutagenesis
    5813 [more info...] 
    5814  
    5815 Chain information for 190l #270 
    5816 --- 
    5817 Chain | Description | UniProt 
    5818 A | LYSOZYME | LYS_BPT4 1-164 
    5819  
    5820 Non-standard residues in 190l #270 
    5821 --- 
    5822 BME — β-mercaptoethanol 
    5823 CL — chloride ion 
    5824  
    5825 Deleted 9 C-terminal residues, 2 N-terminal residues, 69 non-polymer residues
    5826 more than 3.0 Angstroms away. 
    5827 Alignment of 190l chain A to query has RMSD 0.973 using 46 of 127 paired
    5828 residues within cutoff distance 2.0 
    5829 2huk title: 
    5830 Crystal structure of T4 Lysozyme V131C synthetic dimer [more info...] 
    5831  
    5832 Chain information for 2huk #271 
    5833 --- 
    5834 Chain | Description | UniProt 
    5835 A | Lysozyme | LYS_BPT4 1-164 
    5836  
    5837 Non-standard residues in 2huk #271 
    5838 --- 
    5839 SO4 — sulfate ion 
    5840  
    5841 2huk mmCIF Assemblies 
    5842 --- 
    5843 1| author_defined_assembly 
    5844  
    5845 9 atoms have alternate locations. Control/examine alternate locations with
    5846 Altloc Explorer [start tool...] or the altlocs command. 
    5847 Deleted 11 C-terminal residues, 2 N-terminal residues, 33 non-polymer residues
    5848 more than 3.0 Angstroms away. 
    5849 Alignment of 2huk chain A to query has RMSD 1.04 using 54 of 127 paired
    5850 residues within cutoff distance 2.0 
    5851 236l title: 
    5852 The response of T4 lysozyme to large-to-small substitutions within the core
    5853 and its relation to the hydrophobic effect [more info...] 
    5854  
    5855 Chain information for 236l #272 
    5856 --- 
    5857 Chain | Description | UniProt 
    5858 A | T4 LYSOZYME | LYS_BPT4 1-164 
    5859  
    5860 Non-standard residues in 236l #272 
    5861 --- 
    5862 CL — chloride ion 
    5863 HED — 2-hydroxyethyl disulfide 
    5864  
    5865 Deleted 9 C-terminal residues, 2 N-terminal residues, 61 non-polymer residues
    5866 more than 3.0 Angstroms away. 
    5867 Alignment of 236l chain A to query has RMSD 1.03 using 50 of 127 paired
    5868 residues within cutoff distance 2.0 
    5869 Fetching compressed mmCIF 1ovk from http://files.rcsb.org/download/1ovk.cif 
    5870 Fetching CCD NYL from
    5871 https://files.wwpdb.org/pub/pdb/refdata/chem_comp/L/NYL/NYL.cif 
    5872 1ovk title: 
    5873 T4 Lysozyme Cavity Mutant L99A/M102Q Bound with N-Allyl-Aniline [more info...] 
    5874  
    5875 Chain information for 1ovk #273 
    5876 --- 
    5877 Chain | Description | UniProt 
    5878 A | Lysozyme | LYS_BPT4 1-164 
    5879  
    5880 Non-standard residues in 1ovk #273 
    5881 --- 
    5882 BME — β-mercaptoethanol 
    5883 CL — chloride ion 
    5884 NYL — N-allyl-aniline 
    5885  
    5886 Deleted 9 C-terminal residues, 2 N-terminal residues, 25 non-polymer residues
    5887 more than 3.0 Angstroms away. 
    5888 Alignment of 1ovk chain A to query has RMSD 0.99 using 48 of 124 paired
    5889 residues within cutoff distance 2.0 
    5890 1c6t title: 
    5891 T4 lysozyme mutant C54T/C97A In the presence of 8 atm xenon [more info...] 
    5892  
    5893 Chain information for 1c6t #274 
    5894 --- 
    5895 Chain | Description | UniProt 
    5896 A | PROTEIN (LYSOZYME) | LYCV_BPT4 1-164 
    5897  
    5898 Non-standard residues in 1c6t #274 
    5899 --- 
    5900 BME — β-mercaptoethanol 
    5901 CL — chloride ion 
    5902 XE — XENON 
    5903  
    5904 Deleted 9 C-terminal residues, 2 N-terminal residues, 61 non-polymer residues
    5905 more than 3.0 Angstroms away. 
    5906 Alignment of 1c6t chain A to query has RMSD 0.981 using 49 of 125 paired
    5907 residues within cutoff distance 2.0 
    5908 160l title: 
    5909 Control of enzyme activity by an engineered disulfide bond [more info...] 
    5910  
    5911 Chain information for 160l #275 
    5912 --- 
    5913 Chain | Description | UniProt 
    5914 A | T4 LYSOZYME | LYCV_BPT4 1-164 
    5915  
    5916 Non-standard residues in 160l #275 
    5917 --- 
    5918 BME — β-mercaptoethanol 
    5919 CL — chloride ion 
    5920  
    5921 Deleted 9 C-terminal residues, 2 N-terminal residues, 74 non-polymer residues
    5922 more than 3.0 Angstroms away. 
    5923 Alignment of 160l chain A to query has RMSD 0.997 using 48 of 125 paired
    5924 residues within cutoff distance 2.0 
    5925 139l title: 
    5926 Rapid crystallization of T4 lysozyme by intermolecular disulfide crosslinking
    5927 [more info...] 
    5928  
    5929 Chain information for 139l #276 
    5930 --- 
    5931 Chain | Description | UniProt 
    5932 A | T4 LYSOZYME | LYCV_BPT4 1-164 
    5933  
    5934 Non-standard residues in 139l #276 
    5935 --- 
    5936 BME — β-mercaptoethanol 
    5937 CL — chloride ion 
    5938  
    5939 139l mmCIF Assemblies 
    5940 --- 
    5941 1| author_defined_assembly 
    5942 2| software_defined_assembly 
    5943  
    5944 Deleted 9 C-terminal residues, 2 N-terminal residues, 68 non-polymer residues
    5945 more than 3.0 Angstroms away. 
    5946 Alignment of 139l chain A to query has RMSD 0.976 using 48 of 125 paired
    5947 residues within cutoff distance 2.0 
    5948 123l title: 
    5949 The energetic cost and the structural consequences of burying A hydroxyl group
    5950 within the core of A protein determined from ala to ser and val to THR
    5951 substitutions In T4 lysozyme [more info...] 
    5952  
    5953 Chain information for 123l #277 
    5954 --- 
    5955 Chain | Description | UniProt 
    5956 A | T4 LYSOZYME | LYCV_BPT4 1-164 
    5957  
    5958 Non-standard residues in 123l #277 
    5959 --- 
    5960 BME — β-mercaptoethanol 
    5961 CL — chloride ion 
    5962  
    5963 Deleted 9 C-terminal residues, 2 N-terminal residues, 67 non-polymer residues
    5964 more than 3.0 Angstroms away. 
    5965 Alignment of 123l chain A to query has RMSD 0.999 using 48 of 125 paired
    5966 residues within cutoff distance 2.0 
    5967 5wf6 title: 
    5968 Agonist bound human A2a adenosine receptor with S91A mutation at 2.90 A
    5969 resolution [more info...] 
    5970  
    5971 Chain information for 5wf6 #278 
    5972 --- 
    5973 Chain | Description | UniProt 
    5974 A | Human A2a adenosine receptor T4L chimera | AA2AR_HUMAN 2-208 222-316, ENLYS_BPT4 1002-1161 
    5975  
    5976 Non-standard residues in 5wf6 #278 
    5977 --- 
    5978 OLC — (2R)-2,3-dihydroxypropyl (9Z)-octadec-9-enoate (1-Oleoyl-R-glycerol) 
    5979 UKA —
    5980 6-(2,2-diphenylethylamino)-9-[(2R,3R,4S,5S)-5-(ethylcarbamoyl)-3,4-dihydroxy-
    5981 oxolan-2-yl]-N-[2-[(1-pyridin-2-ylpiperidin-4-yl)carbamoylamino]ethyl]purine-2-carboxamide 
    5982  
    5983 Deleted 94 C-terminal residues, 184 N-terminal residues, 4 non-polymer
    5984 residues more than 3.0 Angstroms away. 
    5985 Alignment of 5wf6 chain A to query has RMSD 1.15 using 62 of 136 paired
    5986 residues within cutoff distance 2.0 
    5987 249l title: 
    5988 The response of T4 lysozyme to large-to-small substitutions within the core
    5989 and its relation to the hydrophobic effect [more info...] 
    5990  
    5991 Chain information for 249l #279 
    5992 --- 
    5993 Chain | Description | UniProt 
    5994 A | T4 LYSOZYME | LYS_BPT4 1-164 
    5995  
    5996 Non-standard residues in 249l #279 
    5997 --- 
    5998 CL — chloride ion 
    5999 HED — 2-hydroxyethyl disulfide 
    6000  
    6001 Deleted 11 C-terminal residues, 2 N-terminal residues, 72 non-polymer residues
    6002 more than 3.0 Angstroms away. 
    6003 Alignment of 249l chain A to query has RMSD 0.968 using 47 of 125 paired
    6004 residues within cutoff distance 2.0 
    6005 235l title: 
    6006 The response of T4 lysozyme to large-to-small substitutions within the core
    6007 and its relation to the hydrophobic effect [more info...] 
    6008  
    6009 Chain information for 235l #280 
    6010 --- 
    6011 Chain | Description | UniProt 
    6012 A | T4 LYSOZYME | LYS_BPT4 1-164 
    6013  
    6014 Non-standard residues in 235l #280 
    6015 --- 
    6016 CL — chloride ion 
    6017 HED — 2-hydroxyethyl disulfide 
    6018  
    6019 Deleted 9 C-terminal residues, 2 N-terminal residues, 66 non-polymer residues
    6020 more than 3.0 Angstroms away. 
    6021 Alignment of 235l chain A to query has RMSD 1.01 using 48 of 125 paired
    6022 residues within cutoff distance 2.0 
    6023 1ssy title: 
    6024 Crystal structure of phage T4 lysozyme mutant G28A/I29A/G30A/C54T/C97A [more
    6025 info...] 
    6026  
    6027 Chain information for 1ssy #281 
    6028 --- 
    6029 Chain | Description | UniProt 
    6030 A B | Lysozyme | LYS_BPT4 1-164 
    6031  
    6032 1ssy mmCIF Assemblies 
    6033 --- 
    6034 1| author_defined_assembly 
    6035 2| author_defined_assembly 
    6036  
    6037 Deleted 1 extra chains, 11 C-terminal residues, 2 N-terminal residues, 57 non-
    6038 polymer residues more than 3.0 Angstroms away. 
    6039 Alignment of 1ssy chain B to query has RMSD 0.901 using 45 of 125 paired
    6040 residues within cutoff distance 2.0 
    6041 1nhb title: 
    6042 Specificity of ligand binding in a buried non-polar cavity of t4 lysozyme:
    6043 linkage of dynamics and structural plasticity [more info...] 
    6044  
    6045 Chain information for 1nhb #282 
    6046 --- 
    6047 Chain | Description | UniProt 
    6048 A | T4 LYSOZYME | LYS_BPT4 1-164 
    6049  
    6050 Non-standard residues in 1nhb #282 
    6051 --- 
    6052 CL — chloride ion 
    6053 HED — 2-hydroxyethyl disulfide 
    6054 PYJ — phenylethane 
    6055  
    6056 Deleted 9 C-terminal residues, 2 N-terminal residues, 63 non-polymer residues
    6057 more than 3.0 Angstroms away. 
    6058 Alignment of 1nhb chain A to query has RMSD 0.982 using 49 of 127 paired
    6059 residues within cutoff distance 2.0 
    6060 1l49 title: 
    6061 Structural and thermodynamic analysis of the packing of two α-helices In
    6062 bacteriophage T4 lysozyme [more info...] 
    6063  
    6064 Chain information for 1l49 #283 
    6065 --- 
    6066 Chain | Description | UniProt 
    6067 A | T4 LYSOZYME | LYS_BPT4 1-164 
    6068  
    6069 Deleted 11 C-terminal residues, 2 N-terminal residues, 71 non-polymer residues
    6070 more than 3.0 Angstroms away. 
    6071 Alignment of 1l49 chain A to query has RMSD 1.1 using 49 of 125 paired
    6072 residues within cutoff distance 2.0 
    6073 1l33 title: 
    6074 Contributions of left-handed helical residues to the structure and stability
    6075 of bacteriophage T4 lysozyme [more info...] 
    6076  
    6077 Chain information for 1l33 #284 
    6078 --- 
    6079 Chain | Description | UniProt 
    6080 A | T4 LYSOZYME | LYS_BPT4 1-164 
    6081  
    6082 Deleted 11 C-terminal residues, 2 N-terminal residues, 68 non-polymer residues
    6083 more than 3.0 Angstroms away. 
    6084 Alignment of 1l33 chain A to query has RMSD 1.03 using 49 of 125 paired
    6085 residues within cutoff distance 2.0 
    6086 1c64 title: 
    6087 T4 lysozyme mutant C54T/C97A/L121A In the presence of 8 atm krypton [more
    6088 info...] 
    6089  
    6090 Chain information for 1c64 #285 
    6091 --- 
    6092 Chain | Description | UniProt 
    6093 A | PROTEIN (LYSOZYME) | LYCV_BPT4 1-164 
    6094  
    6095 Non-standard residues in 1c64 #285 
    6096 --- 
    6097 BME — β-mercaptoethanol 
    6098 CL — chloride ion 
    6099 KR — krypton 
    6100  
    6101 Deleted 9 C-terminal residues, 2 N-terminal residues, 64 non-polymer residues
    6102 more than 3.0 Angstroms away. 
    6103 Alignment of 1c64 chain A to query has RMSD 1.03 using 50 of 126 paired
    6104 residues within cutoff distance 2.0 
    6105 241l title: 
    6106 The response of T4 lysozyme to large-to-small substitutions within the core
    6107 and its relation to the hydrophobic effect [more info...] 
    6108  
    6109 Chain information for 241l #286 
    6110 --- 
    6111 Chain | Description | UniProt 
    6112 A | T4 LYSOZYME | LYS_BPT4 1-164 
    6113  
    6114 Non-standard residues in 241l #286 
    6115 --- 
    6116 CL — chloride ion 
    6117 HED — 2-hydroxyethyl disulfide 
    6118  
    6119 Deleted 9 C-terminal residues, 2 N-terminal residues, 68 non-polymer residues
    6120 more than 3.0 Angstroms away. 
    6121 Alignment of 241l chain A to query has RMSD 0.932 using 46 of 125 paired
    6122 residues within cutoff distance 2.0 
    6123 1t97 title: 
    6124 Use of sequence duplication to engineer a ligand-triggered long-distance
    6125 molecular switch in T4 Lysozyme [more info...] 
    6126  
    6127 Chain information for 1t97 #287 
    6128 --- 
    6129 Chain | Description | UniProt 
    6130 A B | Lysozyme | LYS_BPT4 1-175 
    6131  
    6132 1t97 mmCIF Assemblies 
    6133 --- 
    6134 1| author_defined_assembly 
    6135 2| author_defined_assembly 
    6136  
    6137 Deleted 1 extra chains, 9 C-terminal residues, 2 N-terminal residues, 60 non-
    6138 polymer residues more than 3.0 Angstroms away. 
    6139 Alignment of 1t97 chain A to query has RMSD 0.91 using 45 of 131 paired
    6140 residues within cutoff distance 2.0 
    6141 1cv4 title: 
    6142 T4 lysozyme mutant L118M [more info...] 
    6143  
    6144 Chain information for 1cv4 #288 
    6145 --- 
    6146 Chain | Description | UniProt 
    6147 A | LYSOZYME | LYS_BPT4 1-164 
    6148  
    6149 Non-standard residues in 1cv4 #288 
    6150 --- 
    6151 CL — chloride ion 
    6152 HED — 2-hydroxyethyl disulfide 
    6153  
    6154 Deleted 9 C-terminal residues, 2 N-terminal residues, 71 non-polymer residues
    6155 more than 3.0 Angstroms away. 
    6156 Alignment of 1cv4 chain A to query has RMSD 1.02 using 48 of 125 paired
    6157 residues within cutoff distance 2.0 
    6158 159l title: 
    6159 Control of enzyme activity by an engineered disulfide bond [more info...] 
    6160  
    6161 Chain information for 159l #289 
    6162 --- 
    6163 Chain | Description | UniProt 
    6164 A | T4 LYSOZYME | LYCV_BPT4 1-164 
    6165  
    6166 Non-standard residues in 159l #289 
    6167 --- 
    6168 BME — β-mercaptoethanol 
    6169 CL — chloride ion 
    6170  
    6171 Deleted 9 C-terminal residues, 2 N-terminal residues, 76 non-polymer residues
    6172 more than 3.0 Angstroms away. 
    6173 Alignment of 159l chain A to query has RMSD 0.945 using 47 of 125 paired
    6174 residues within cutoff distance 2.0 
    6175 Fetching compressed mmCIF 6m9t from http://files.rcsb.org/download/6m9t.cif 
    6176 Fetching CCD J9P from
    6177 https://files.wwpdb.org/pub/pdb/refdata/chem_comp/P/J9P/J9P.cif 
    6178 6m9t title: 
    6179 Crystal structure of EP3 receptor bound to misoprostol-FA [more info...] 
    6180  
    6181 Chain information for 6m9t #290 
    6182 --- 
    6183 Chain | Description | UniProt 
    6184 A | Prostaglandin E2 receptor EP3 subtype, Endolysin chimera | PE2R3_HUMAN 2-259 273-353, ENLYS_BPT4 1002-1161 
    6185  
    6186 Non-standard residues in 6m9t #290 
    6187 --- 
    6188 J9P —
    6189 (11alpha,12alpha,13E,16S)-11,16-dihydroxy-16-methyl-9-oxoprost-13-en-1-oic
    6190 acid 
    6191 OLA — oleic acid 
    6192 OLC — (2R)-2,3-dihydroxypropyl (9Z)-octadec-9-enoate (1-Oleoyl-R-glycerol) 
    6193 SO4 — sulfate ion 
    6194  
    6195 22 atoms have alternate locations. Control/examine alternate locations with
    6196 Altloc Explorer [start tool...] or the altlocs command. 
    6197 3416 atoms have anisotropic B-factors. Depict anisotropic information with
    6198 Thermal Ellipsoids [start tool...] or the aniso command. 
    6199 Deleted 87 C-terminal residues, 204 N-terminal residues, 13 non-polymer
    6200 residues more than 3.0 Angstroms away. 
    6201 Alignment of 6m9t chain A to query has RMSD 1.38 using 75 of 128 paired
    6202 residues within cutoff distance 2.0 
    6203 4e97 title: 
    6204 T4 Lysozyme L99A/M102H with 2-Mercaptoethanol Bound [more info...] 
    6205  
    6206 Chain information for 4e97 #291 
    6207 --- 
    6208 Chain | Description | UniProt 
    6209 A B | Lysozyme | LYS_BPT4 1-164 
    6210  
    6211 Non-standard residues in 4e97 #291 
    6212 --- 
    6213 ACT — acetate ion 
    6214 BME — β-mercaptoethanol 
    6215 HED — 2-hydroxyethyl disulfide 
    6216 SO4 — sulfate ion 
    6217  
    6218 4e97 mmCIF Assemblies 
    6219 --- 
    6220 1| author_defined_assembly 
    6221 2| author_defined_assembly 
    6222  
    6223 305 atoms have alternate locations. Control/examine alternate locations with
    6224 Altloc Explorer [start tool...] or the altlocs command. 
    6225 2848 atoms have anisotropic B-factors. Depict anisotropic information with
    6226 Thermal Ellipsoids [start tool...] or the aniso command. 
    6227 Deleted 1 extra chains, 11 C-terminal residues, 3 N-terminal residues, 288
    6228 non-polymer residues more than 3.0 Angstroms away. 
    6229 Alignment of 4e97 chain B to query has RMSD 1.14 using 45 of 139 paired
    6230 residues within cutoff distance 2.0 
    6231 253l title: 
    6232 Lysozyme [more info...] 
    6233  
    6234 Chain information for 253l #292 
    6235 --- 
    6236 Chain | Description | UniProt 
    6237 A | LYSOZYME | LYS_BPT4 1-164 
    6238  
    6239 Non-standard residues in 253l #292 
    6240 --- 
    6241 BME — β-mercaptoethanol 
    6242 CL — chloride ion 
    6243  
    6244 Deleted 11 C-terminal residues, 2 N-terminal residues, 71 non-polymer residues
    6245 more than 3.0 Angstroms away. 
    6246 Alignment of 253l chain A to query has RMSD 0.936 using 46 of 125 paired
    6247 residues within cutoff distance 2.0 
    6248 234l title: 
    6249 T4 lysozyme mutant M106L [more info...] 
    6250  
    6251 Chain information for 234l #293 
    6252 --- 
    6253 Chain | Description | UniProt 
    6254 A | T4 LYSOZYME | LYS_BPT4 1-164 
    6255  
    6256 Non-standard residues in 234l #293 
    6257 --- 
    6258 BME — β-mercaptoethanol 
    6259 CL — chloride ion 
    6260  
    6261 Deleted 9 C-terminal residues, 2 N-terminal residues, 63 non-polymer residues
    6262 more than 3.0 Angstroms away. 
    6263 Alignment of 234l chain A to query has RMSD 1.01 using 49 of 125 paired
    6264 residues within cutoff distance 2.0 
    6265 1qug title: 
    6266 E108V mutant of T4 lysozyme [more info...] 
    6267  
    6268 Chain information for 1qug #294 
    6269 --- 
    6270 Chain | Description | UniProt 
    6271 A | PROTEIN (LYSOZYME) | LYS_BPT4 1-162 
    6272  
    6273 Non-standard residues in 1qug #294 
    6274 --- 
    6275 CL — chloride ion 
    6276 HED — 2-hydroxyethyl disulfide 
    6277  
    6278 Deleted 9 C-terminal residues, 2 N-terminal residues, 43 non-polymer residues
    6279 more than 3.0 Angstroms away. 
    6280 Alignment of 1qug chain A to query has RMSD 0.945 using 47 of 127 paired
    6281 residues within cutoff distance 2.0 
    6282 1p64 title: 
    6283 T4 lysozyme core repacking mutant L133F/Ta [more info...] 
    6284  
    6285 Chain information for 1p64 #295 
    6286 --- 
    6287 Chain | Description | UniProt 
    6288 A | LYSOZYME | LYS_BPT4 1-164 
    6289  
    6290 Non-standard residues in 1p64 #295 
    6291 --- 
    6292 CL — chloride ion 
    6293 HED — 2-hydroxyethyl disulfide 
    6294 K — potassium ion 
    6295  
    6296 13 atoms have alternate locations. Control/examine alternate locations with
    6297 Altloc Explorer [start tool...] or the altlocs command. 
    6298 Deleted 11 C-terminal residues, 2 N-terminal residues, 84 non-polymer residues
    6299 more than 3.0 Angstroms away. 
    6300 Alignment of 1p64 chain A to query has RMSD 1.02 using 48 of 125 paired
    6301 residues within cutoff distance 2.0 
    6302 1l56 title: 
    6303 Analysis of the interaction between charged side chains and the α-helix dipole
    6304 using designed thermostable mutants of phage T4 lysozyme [more info...] 
    6305  
    6306 Chain information for 1l56 #296 
    6307 --- 
    6308 Chain | Description | UniProt 
    6309 A | T4 LYSOZYME | LYS_BPT4 1-164 
    6310  
    6311 Non-standard residues in 1l56 #296 
    6312 --- 
    6313 BME — β-mercaptoethanol 
    6314  
    6315 Deleted 11 C-terminal residues, 2 N-terminal residues, 77 non-polymer residues
    6316 more than 3.0 Angstroms away. 
    6317 Alignment of 1l56 chain A to query has RMSD 0.937 using 45 of 127 paired
    6318 residues within cutoff distance 2.0 
    6319 1g0q title: 
    6320 Crystal structure of T4 lysozyme mutant V149I [more info...] 
    6321  
    6322 Chain information for 1g0q #297 
    6323 --- 
    6324 Chain | Description | UniProt 
    6325 A | PROTEIN (LYSOZYME) | LYS_BPT4 1-164 
    6326  
    6327 Non-standard residues in 1g0q #297 
    6328 --- 
    6329 CL — chloride ion 
    6330 HED — 2-hydroxyethyl disulfide 
    6331  
    6332 Deleted 11 C-terminal residues, 2 N-terminal residues, 72 non-polymer residues
    6333 more than 3.0 Angstroms away. 
    6334 Alignment of 1g0q chain A to query has RMSD 1.02 using 49 of 127 paired
    6335 residues within cutoff distance 2.0 
    6336 Fetching compressed mmCIF 1dye from http://files.rcsb.org/download/1dye.cif 
    6337 1dye title: 
    6338 Determination of α-helix propensity within the context of A folded protein:
    6339 sites 44 and 131 In bacteriophage T4 lysozyme [more info...] 
    6340  
    6341 Chain information for 1dye #298 
    6342 --- 
    6343 Chain | Description | UniProt 
    6344 A | T4 LYSOZYME | LYS_BPT4 1-164 
    6345  
    6346 Non-standard residues in 1dye #298 
    6347 --- 
    6348 BME — β-mercaptoethanol 
    6349 CL — chloride ion 
    6350  
    6351 Deleted 9 C-terminal residues, 2 N-terminal residues, 67 non-polymer residues
    6352 more than 3.0 Angstroms away. 
    6353 Alignment of 1dye chain A to query has RMSD 1.05 using 49 of 127 paired
    6354 residues within cutoff distance 2.0 
    6355 156l title: 
    6356 Control of enzyme activity by an engineered disulfide bond [more info...] 
    6357  
    6358 Chain information for 156l #299 
    6359 --- 
    6360 Chain | Description | UniProt 
    6361 A | T4 LYSOZYME | LYCV_BPT4 1-164 
    6362  
    6363 Non-standard residues in 156l #299 
    6364 --- 
    6365 BME — β-mercaptoethanol 
    6366 CL — chloride ion 
    6367  
    6368 Deleted 9 C-terminal residues, 2 N-terminal residues, 78 non-polymer residues
    6369 more than 3.0 Angstroms away. 
    6370 Alignment of 156l chain A to query has RMSD 0.973 using 47 of 125 paired
    6371 residues within cutoff distance 2.0 
    6372 109l title: 
    6373 Structural basis of α-helix propensity At two sites In T4 lysozyme [more
    6374 info...] 
    6375  
    6376 Chain information for 109l #300 
    6377 --- 
    6378 Chain | Description | UniProt 
    6379 A | T4 LYSOZYME | LYCV_BPT4 1-164 
    6380  
    6381 Non-standard residues in 109l #300 
    6382 --- 
    6383 BME — β-mercaptoethanol 
    6384 CL — chloride ion 
    6385  
    6386 Deleted 9 C-terminal residues, 2 N-terminal residues, 66 non-polymer residues
    6387 more than 3.0 Angstroms away. 
    6388 Alignment of 109l chain A to query has RMSD 0.986 using 44 of 122 paired
    6389 residues within cutoff distance 2.0 
    6390 4i7j title: 
    6391 T4 Lysozyme L99A/M102H with benzene bound [more info...] 
    6392  
    6393 Chain information for 4i7j #301 
    6394 --- 
    6395 Chain | Description | UniProt 
    6396 A B | Lysozyme | LYS_BPT4 1-164 
    6397  
    6398 Non-standard residues in 4i7j #301 
    6399 --- 
    6400 ACT — acetate ion 
    6401 BME — β-mercaptoethanol 
    6402 BNZ — benzene 
    6403 HED — 2-hydroxyethyl disulfide 
    6404 SO4 — sulfate ion 
    6405  
    6406 4i7j mmCIF Assemblies 
    6407 --- 
    6408 1| author_defined_assembly 
    6409 2| author_defined_assembly 
    6410  
    6411 104 atoms have alternate locations. Control/examine alternate locations with
    6412 Altloc Explorer [start tool...] or the altlocs command. 
    6413 2809 atoms have anisotropic B-factors. Depict anisotropic information with
    6414 Thermal Ellipsoids [start tool...] or the aniso command. 
    6415 Deleted 1 extra chains, 11 C-terminal residues, 13 N-terminal residues, 178
    6416 non-polymer residues more than 3.0 Angstroms away. 
    6417 Alignment of 4i7j chain A to query has RMSD 1.2 using 47 of 126 paired
    6418 residues within cutoff distance 2.0 
    6419 257l title: 
    6420 AN adaptable metal-binding site engineered INTO T4 lysozyme [more info...] 
    6421  
    6422 Chain information for 257l #302 
    6423 --- 
    6424 Chain | Description | UniProt 
    6425 A | PROTEIN (LYSOZYME) | LYS_BPT4 1-164 
    6426  
    6427 Non-standard residues in 257l #302 
    6428 --- 
    6429 CL — chloride ion 
    6430 HED — 2-hydroxyethyl disulfide 
    6431  
    6432 Deleted 9 C-terminal residues, 2 N-terminal residues, 58 non-polymer residues
    6433 more than 3.0 Angstroms away. 
    6434 Alignment of 257l chain A to query has RMSD 1.03 using 49 of 125 paired
    6435 residues within cutoff distance 2.0 
    6436 248l title: 
    6437 The response of T4 lysozyme to large-to-small substitutions within the core
    6438 and its relation to the hydrophobic effect [more info...] 
    6439  
    6440 Chain information for 248l #303 
    6441 --- 
    6442 Chain | Description | UniProt 
    6443 A | T4 LYSOZYME | LYS_BPT4 1-164 
    6444  
    6445 Non-standard residues in 248l #303 
    6446 --- 
    6447 CL — chloride ion 
    6448 HED — 2-hydroxyethyl disulfide 
    6449  
    6450 Deleted 9 C-terminal residues, 2 N-terminal residues, 68 non-polymer residues
    6451 more than 3.0 Angstroms away. 
    6452 Alignment of 248l chain A to query has RMSD 0.908 using 45 of 125 paired
    6453 residues within cutoff distance 2.0 
    6454 246l title: 
    6455 The response of T4 lysozyme to large-to-small substitutions within the core
    6456 and its relation to the hydrophobic effect [more info...] 
    6457  
    6458 Chain information for 246l #304 
    6459 --- 
    6460 Chain | Description | UniProt 
    6461 A | T4 LYSOZYME | LYS_BPT4 1-164 
    6462  
    6463 Non-standard residues in 246l #304 
    6464 --- 
    6465 CL — chloride ion 
    6466 HED — 2-hydroxyethyl disulfide 
    6467  
    6468 Deleted 11 C-terminal residues, 2 N-terminal residues, 77 non-polymer residues
    6469 more than 3.0 Angstroms away. 
    6470 Alignment of 246l chain A to query has RMSD 0.973 using 48 of 125 paired
    6471 residues within cutoff distance 2.0 
    6472 Fetching compressed mmCIF 1l0k from http://files.rcsb.org/download/1l0k.cif 
    6473 1l0k title: 
    6474 Methionine core mutant of T4 lysozyme [more info...] 
    6475  
    6476 Chain information for 1l0k #305 
    6477 --- 
    6478 Chain | Description | UniProt 
    6479 A | LYSOZYME | LYS_BPT4 1-162 
    6480  
    6481 Non-standard residues in 1l0k #305 
    6482 --- 
    6483 CL — chloride ion 
    6484 HED — 2-hydroxyethyl disulfide 
    6485  
    6486 Deleted 9 C-terminal residues, 2 N-terminal residues, 51 non-polymer residues
    6487 more than 3.0 Angstroms away. 
    6488 Alignment of 1l0k chain A to query has RMSD 0.938 using 41 of 122 paired
    6489 residues within cutoff distance 2.0 
    6490 1d3f title: 
    6491 N-terminal domain core methionine mutation [more info...] 
    6492  
    6493 Chain information for 1d3f #306 
    6494 --- 
    6495 Chain | Description | UniProt 
    6496 A | LYSOZYME | LYS_BPT4 1-164 
    6497  
    6498 Non-standard residues in 1d3f #306 
    6499 --- 
    6500 CL — chloride ion 
    6501 HED — 2-hydroxyethyl disulfide 
    6502  
    6503 Deleted 9 C-terminal residues, 2 N-terminal residues, 51 non-polymer residues
    6504 more than 3.0 Angstroms away. 
    6505 Alignment of 1d3f chain A to query has RMSD 0.99 using 48 of 125 paired
    6506 residues within cutoff distance 2.0 
    6507 1c60 title: 
    6508 T4 lysozyme mutant C54T/C97A/F153A In the presence of 8 atm argon [more
    6509 info...] 
    6510  
    6511 Chain information for 1c60 #307 
    6512 --- 
    6513 Chain | Description | UniProt 
    6514 A | PROTEIN (LYSOZYME) | LYCV_BPT4 1-164 
    6515  
    6516 Non-standard residues in 1c60 #307 
    6517 --- 
    6518 BME — β-mercaptoethanol 
    6519 CL — chloride ion 
    6520  
    6521 Deleted 9 C-terminal residues, 2 N-terminal residues, 63 non-polymer residues
    6522 more than 3.0 Angstroms away. 
    6523 Alignment of 1c60 chain A to query has RMSD 1.02 using 49 of 125 paired
    6524 residues within cutoff distance 2.0 
    6525 165l title: 
    6526 Control of enzyme activity by an engineered disulfide bond [more info...] 
    6527  
    6528 Chain information for 165l #308 
    6529 --- 
    6530 Chain | Description | UniProt 
    6531 A | T4 LYSOZYME | LYCV_BPT4 1-164 
    6532  
    6533 Non-standard residues in 165l #308 
    6534 --- 
    6535 BME — β-mercaptoethanol 
    6536 CL — chloride ion 
    6537  
    6538 Deleted 9 C-terminal residues, 2 N-terminal residues, 66 non-polymer residues
    6539 more than 3.0 Angstroms away. 
    6540 Alignment of 165l chain A to query has RMSD 0.994 using 48 of 125 paired
    6541 residues within cutoff distance 2.0 
    6542 Fetching compressed mmCIF 6d9m from http://files.rcsb.org/download/6d9m.cif 
    6543 Fetching CCD GMP from
    6544 https://files.wwpdb.org/pub/pdb/refdata/chem_comp/P/GMP/GMP.cif 
    6545 Fetching CCD GTP from
    6546 https://files.wwpdb.org/pub/pdb/refdata/chem_comp/P/GTP/GTP.cif 
    6547 Fetching CCD POP from
    6548 https://files.wwpdb.org/pub/pdb/refdata/chem_comp/P/POP/POP.cif 
    6549 6d9m title: 
    6550 T4-Lysozyme fusion to Geobacter GGDEF [more info...] 
    6551  
    6552 Chain information for 6d9m #309 
    6553 --- 
    6554 Chain | Description | UniProt 
    6555 A | Fusion protein of Endolysin,Response receiver sensor diguanylate cyclase, GAF domain-containing | D9IEF7_BPT4 -162--2, Q39UD1_GEOMG 1-166 
    6556  
    6557 Non-standard residues in 6d9m #309 
    6558 --- 
    6559 ACT — acetate ion 
    6560 GMP — guanosine 
    6561 GOL — glycerol (glycerin; propane-1,2,3-triol) 
    6562 GTP — guanosine-5'-triphosphate 
    6563 MG — magnesium ion 
    6564 POP — pyrophosphate 2- 
    6565  
    6566 196 atoms have alternate locations. Control/examine alternate locations with
    6567 Altloc Explorer [start tool...] or the altlocs command. 
    6568 2577 atoms have anisotropic B-factors. Depict anisotropic information with
    6569 Thermal Ellipsoids [start tool...] or the aniso command. 
    6570 Deleted 173 C-terminal residues, 2 N-terminal residues, 301 non-polymer
    6571 residues more than 3.0 Angstroms away. 
    6572 Alignment of 6d9m chain A to query has RMSD 1.3 using 57 of 125 paired
    6573 residues within cutoff distance 2.0 
    6574 Fetching compressed mmCIF 5v83 from http://files.rcsb.org/download/5v83.cif 
    6575 Fetching CCD 8Z7 from
    6576 https://files.wwpdb.org/pub/pdb/refdata/chem_comp/7/8Z7/8Z7.cif 
    6577 5v83 title: 
    6578 Structure of DCN1 bound to NAcM-HIT [more info...] 
    6579  
    6580 Chain information for 5v83 #310 
    6581 --- 
    6582 Chain | Description | UniProt 
    6583 A | Lysozyme,DCN1-like protein 1 chimera | D9IEF7_BPT4 1-164, DCNL1_HUMAN 1062-1259 
    6584  
    6585 Non-standard residues in 5v83 #310 
    6586 --- 
    6587 8Z7 — N-(1-benzylpiperidin-4-yl)-N'-[3-(trifluoromethyl)phenyl]urea 
    6588  
    6589 2925 atoms have anisotropic B-factors. Depict anisotropic information with
    6590 Thermal Ellipsoids [start tool...] or the aniso command. 
    6591 Deleted 199 C-terminal residues, 14 N-terminal residues, 198 non-polymer
    6592 residues more than 3.0 Angstroms away. 
    6593 Alignment of 5v83 chain A to query has RMSD 1.22 using 64 of 121 paired
    6594 residues within cutoff distance 2.0 
    6595 5jww title: 
    6596 T4 Lysozyme L99A/M102Q with 1-Hydro-2-ethyl-1,2-azaborine Bound [more info...] 
    6597  
    6598 Chain information for 5jww #311 
    6599 --- 
    6600 Chain | Description | UniProt 
    6601 A | Endolysin | ENLYS_BPT4 1-164 
    6602  
    6603 Non-standard residues in 5jww #311 
    6604 --- 
    6605 6OQ — 2-ethyl-1,2-dihydro-1,2-azaborinine 
    6606 CL — chloride ion 
    6607  
    6608 95 atoms have alternate locations. Control/examine alternate locations with
    6609 Altloc Explorer [start tool...] or the altlocs command. 
    6610 Deleted 8 C-terminal residues, 2 N-terminal residues, 162 non-polymer residues
    6611 more than 3.0 Angstroms away. 
    6612 Alignment of 5jww chain A to query has RMSD 0.963 using 43 of 122 paired
    6613 residues within cutoff distance 2.0 
    6614 1l25 title: 
    6615 Replacements of PRO86 In phage T4 lysozyme extend an α-helix but do not alter
    6616 protein stability [more info...] 
    6617  
    6618 Chain information for 1l25 #312 
    6619 --- 
    6620 Chain | Description | UniProt 
    6621 A | T4 LYSOZYME | LYS_BPT4 1-164 
    6622  
    6623 Deleted 11 C-terminal residues, 2 N-terminal residues, 82 non-polymer residues
    6624 more than 3.0 Angstroms away. 
    6625 Alignment of 1l25 chain A to query has RMSD 1.08 using 49 of 125 paired
    6626 residues within cutoff distance 2.0 
    6627 198l title: 
    6628 Thermodynamic and structural compensation In "size-switch" core-repacking
    6629 variants of T4 lysozyme [more info...] 
    6630  
    6631 Chain information for 198l #313 
    6632 --- 
    6633 Chain | Description | UniProt 
    6634 A | LYSOZYME | LYCV_BPT4 1-164 
    6635  
    6636 Non-standard residues in 198l #313 
    6637 --- 
    6638 BME — β-mercaptoethanol 
    6639 CL — chloride ion 
    6640  
    6641 Deleted 9 C-terminal residues, 2 N-terminal residues, 81 non-polymer residues
    6642 more than 3.0 Angstroms away. 
    6643 Alignment of 198l chain A to query has RMSD 0.988 using 50 of 125 paired
    6644 residues within cutoff distance 2.0 
    6645 149l title: 
    6646 Conservation of solvent-binding sites In 10 crystal forms of T4 lysozyme [more
    6647 info...] 
    6648  
    6649 Chain information for 149l #314 
    6650 --- 
    6651 Chain | Description | UniProt 
    6652 A | T4 LYSOZYME | LYS_BPT4 1-164 
    6653  
    6654 Deleted 11 C-terminal residues, 2 N-terminal residues, 15 non-polymer residues
    6655 more than 3.0 Angstroms away. 
    6656 Alignment of 149l chain A to query has RMSD 1.35 using 63 of 124 paired
    6657 residues within cutoff distance 2.0 
    6658 5x33 title: 
    6659 Leukotriene B4 receptor BLT1 in complex with BIIL260 [more info...] 
    6660  
    6661 Chain information for 5x33 #315 
    6662 --- 
    6663 Chain | Description | UniProt 
    6664 A | LTB4 receptor,Lysozyme,LTB4 receptor | Q9WTK1_CAVPO 15-213 214-348, A0A097J792_BPT4 1002-1161 
    6665  
    6666 Non-standard residues in 5x33 #315 
    6667 --- 
    6668 7Y9 —
    6669 4-[[3-[[4-[2-(4-hydroxyphenyl)propan-2-yl]phenoxy]methyl]phenyl]methoxy]benzenecarboximidamide 
    6670  
    6671 3375 atoms have anisotropic B-factors. Depict anisotropic information with
    6672 Thermal Ellipsoids [start tool...] or the aniso command. 
    6673 Deleted 83 C-terminal residues, 186 N-terminal residues, 1 non-polymer
    6674 residues more than 3.0 Angstroms away. 
    6675 Alignment of 5x33 chain A to query has RMSD 1.08 using 53 of 141 paired
    6676 residues within cutoff distance 2.0 
    6677 221l title: 
    6678 The energetic cost and the structural consequences of burying A hydroxyl group
    6679 within the core of A protein determined from ala to ser and val to THR
    6680 substitutions In T4 lysozyme [more info...] 
    6681  
    6682 Chain information for 221l #316 
    6683 --- 
    6684 Chain | Description | UniProt 
    6685 A | T4 LYSOZYME | LYS_BPT4 1-164 
    6686  
    6687 Non-standard residues in 221l #316 
    6688 --- 
    6689 BME — β-mercaptoethanol 
    6690 CL — chloride ion 
    6691  
    6692 Deleted 9 C-terminal residues, 2 N-terminal residues, 54 non-polymer residues
    6693 more than 3.0 Angstroms away. 
    6694 Alignment of 221l chain A to query has RMSD 1 using 49 of 125 paired residues
    6695 within cutoff distance 2.0 
    6696 Fetching compressed mmCIF 1l68 from http://files.rcsb.org/download/1l68.cif 
    6697 1l68 title: 
    6698 Tolerance of T4 lysozyme to multiple xaa (right arrow) ala substitutions: A
    6699 polyalanine α-helix containing ten consecutive alanines [more info...] 
    6700  
    6701 Chain information for 1l68 #317 
    6702 --- 
    6703 Chain | Description | UniProt 
    6704 A | LYSOZYME | LYCV_BPT4 1-164 
    6705  
    6706 Non-standard residues in 1l68 #317 
    6707 --- 
    6708 BME — β-mercaptoethanol 
    6709 CL — chloride ion 
    6710  
    6711 Deleted 9 C-terminal residues, 2 N-terminal residues, 60 non-polymer residues
    6712 more than 3.0 Angstroms away. 
    6713 Alignment of 1l68 chain A to query has RMSD 0.936 using 47 of 125 paired
    6714 residues within cutoff distance 2.0 
    6715 1l27 title: 
    6716 Replacements of PRO86 In phage T4 lysozyme extend an α-helix but do not alter
    6717 protein stability [more info...] 
    6718  
    6719 Chain information for 1l27 #318 
    6720 --- 
    6721 Chain | Description | UniProt 
    6722 A | T4 LYSOZYME | LYS_BPT4 1-164 
    6723  
    6724 Deleted 11 C-terminal residues, 2 N-terminal residues, 74 non-polymer residues
    6725 more than 3.0 Angstroms away. 
    6726 Alignment of 1l27 chain A to query has RMSD 1 using 47 of 127 paired residues
    6727 within cutoff distance 2.0 
    6728 1g1w title: 
    6729 T4 lysozyme mutant C54T/C97A/Q105M [more info...] 
    6730  
    6731 Chain information for 1g1w #319 
    6732 --- 
    6733 Chain | Description | UniProt 
    6734 A | LYSOZYME | LYCV_BPT4 1-164 
    6735  
    6736 Non-standard residues in 1g1w #319 
    6737 --- 
    6738 BME — β-mercaptoethanol 
    6739 CL — chloride ion 
    6740  
    6741 Deleted 9 C-terminal residues, 2 N-terminal residues, 44 non-polymer residues
    6742 more than 3.0 Angstroms away. 
    6743 Alignment of 1g1w chain A to query has RMSD 1.03 using 49 of 127 paired
    6744 residues within cutoff distance 2.0 
    6745 1cup title: 
    6746 Methionine core mutant of T4 lysozyme [more info...] 
    6747  
    6748 Chain information for 1cup #320 
    6749 --- 
    6750 Chain | Description | UniProt 
    6751 A | LYSOZYME | LYS_BPT4 1-164 
    6752  
    6753 Non-standard residues in 1cup #320 
    6754 --- 
    6755 CL — chloride ion 
    6756 HED — 2-hydroxyethyl disulfide 
    6757  
    6758 Deleted 9 C-terminal residues, 2 N-terminal residues, 52 non-polymer residues
    6759 more than 3.0 Angstroms away. 
    6760 Alignment of 1cup chain A to query has RMSD 1.03 using 49 of 125 paired
    6761 residues within cutoff distance 2.0 
    6762 6iih title: 
    6763 crystal structure of mitochondrial calcium uptake 2(MICU2) [more info...] 
    6764  
    6765 Chain information for 6iih #321 
    6766 --- 
    6767 Chain | Description | UniProt 
    6768 A B | Endolysin,Calcium uptake protein 2, mitochondrial | ENLYS_BPT4 1-161, MICU2_HUMAN 164-485 
    6769  
    6770 Non-standard residues in 6iih #321 
    6771 --- 
    6772 CA — calcium ion 
    6773  
    6774 Deleted 1 extra chains, 293 C-terminal residues, 2 N-terminal residues, 675
    6775 non-polymer residues more than 3.0 Angstroms away. 
    6776 Alignment of 6iih chain A to query has RMSD 0.865 using 44 of 124 paired
    6777 residues within cutoff distance 2.0 
    6778 210l title: 
    6779 Protein structure plasticity exemplified by insertion and deletion mutants In
    6780 T4 lysozyme [more info...] 
    6781  
    6782 Chain information for 210l #322 
    6783 --- 
    6784 Chain | Description | UniProt 
    6785 A | T4 LYSOZYME | LYS_BPT4 1-164 
    6786  
    6787 Non-standard residues in 210l #322 
    6788 --- 
    6789 HED — 2-hydroxyethyl disulfide 
    6790  
    6791 Deleted 9 C-terminal residues, 2 N-terminal residues, 60 non-polymer residues
    6792 more than 3.0 Angstroms away. 
    6793 Alignment of 210l chain A to query has RMSD 0.947 using 45 of 127 paired
    6794 residues within cutoff distance 2.0 
    6795 Fetching compressed mmCIF 1l71 from http://files.rcsb.org/download/1l71.cif 
    6796 1l71 title: 
    6797 Multiple stabilizing alanine replacements within α-helix 126-134 of T4
    6798 lysozyme have independent, additive effects on both structure and stability
    6799 [more info...] 
    6800  
    6801 Chain information for 1l71 #323 
    6802 --- 
    6803 Chain | Description | UniProt 
    6804 A | LYSOZYME | LYS_BPT4 1-164 
    6805  
    6806 Non-standard residues in 1l71 #323 
    6807 --- 
    6808 BME — β-mercaptoethanol 
    6809 CL — chloride ion 
    6810  
    6811 Deleted 7 C-terminal residues, 2 N-terminal residues, 74 non-polymer residues
    6812 more than 3.0 Angstroms away. 
    6813 Alignment of 1l71 chain A to query has RMSD 1.03 using 48 of 127 paired
    6814 residues within cutoff distance 2.0 
    6815 1cv0 title: 
    6816 T4 lysozyme mutant F104M [more info...] 
    6817  
    6818 Chain information for 1cv0 #324 
    6819 --- 
    6820 Chain | Description | UniProt 
    6821 A | LYSOZYME | LYS_BPT4 1-164 
    6822  
    6823 Non-standard residues in 1cv0 #324 
    6824 --- 
    6825 CL — chloride ion 
    6826 HED — 2-hydroxyethyl disulfide 
    6827  
    6828 Deleted 9 C-terminal residues, 2 N-terminal residues, 64 non-polymer residues
    6829 more than 3.0 Angstroms away. 
    6830 Alignment of 1cv0 chain A to query has RMSD 1.02 using 49 of 125 paired
    6831 residues within cutoff distance 2.0 
    6832 1c67 title: 
    6833 T4 lysozyme mutant C54T/C97A/L121A/L133A In the presence of 8 atm krypton
    6834 [more info...] 
    6835  
    6836 Chain information for 1c67 #325 
    6837 --- 
    6838 Chain | Description | UniProt 
    6839 A | PROTEIN (LYSOZYME) | LYCV_BPT4 1-164 
    6840  
    6841 Non-standard residues in 1c67 #325 
    6842 --- 
    6843 BME — β-mercaptoethanol 
    6844 CL — chloride ion 
    6845 KR — krypton 
    6846  
    6847 Deleted 9 C-terminal residues, 2 N-terminal residues, 38 non-polymer residues
    6848 more than 3.0 Angstroms away. 
    6849 Alignment of 1c67 chain A to query has RMSD 1.09 using 50 of 125 paired
    6850 residues within cutoff distance 2.0 
    6851 175l title: 
    6852 Protein flexibility and adaptability seen In 25 crystal forms of T4 lysozyme
    6853 [more info...] 
    6854  
    6855 Chain information for 175l #326 
    6856 --- 
    6857 Chain | Description | UniProt 
    6858 A B | T4 LYSOZYME | LYS_BPT4 1-164 
    6859  
    6860 175l mmCIF Assemblies 
    6861 --- 
    6862 1| author_defined_assembly 
    6863 2| author_defined_assembly 
    6864  
    6865 Deleted 1 extra chains, 9 C-terminal residues, 2 N-terminal residues, 65 non-
    6866 polymer residues more than 3.0 Angstroms away. 
    6867 Alignment of 175l chain A to query has RMSD 0.951 using 47 of 128 paired
    6868 residues within cutoff distance 2.0 
    6869 Fetching compressed mmCIF 170l from http://files.rcsb.org/download/170l.cif 
    6870 170l title: 
    6871 Protein flexibility and adaptability seen In 25 crystal forms of T4 lysozyme
    6872 [more info...] 
    6873  
    6874 Chain information for 170l #327 
    6875 --- 
    6876 Chain | Description | UniProt 
    6877 A | T4 LYSOZYME | LYS_BPT4 1-164 
    6878  
    6879 Non-standard residues in 170l #327 
    6880 --- 
    6881 BME — β-mercaptoethanol 
    6882  
    6883 Deleted 11 C-terminal residues, 2 N-terminal residues, 6 non-polymer residues
    6884 more than 3.0 Angstroms away. 
    6885 Alignment of 170l chain A to query has RMSD 0.917 using 45 of 125 paired
    6886 residues within cutoff distance 2.0 
    6887 142l title: 
    6888 Role of backbone flexibility In the accommodation of variants that repack the
    6889 core of T4 lysozyme [more info...] 
    6890  
    6891 Chain information for 142l #328 
    6892 --- 
    6893 Chain | Description | UniProt 
    6894 A | T4 LYSOZYME | LYCV_BPT4 1-164 
    6895  
    6896 Non-standard residues in 142l #328 
    6897 --- 
    6898 BME — β-mercaptoethanol 
    6899 CL — chloride ion 
    6900  
    6901 Deleted 9 C-terminal residues, 2 N-terminal residues, 48 non-polymer residues
    6902 more than 3.0 Angstroms away. 
    6903 Alignment of 142l chain A to query has RMSD 1.07 using 49 of 125 paired
    6904 residues within cutoff distance 2.0 
    6905 Fetching compressed mmCIF 3vw7 from http://files.rcsb.org/download/3vw7.cif 
    6906 Fetching CCD VPX from
    6907 https://files.wwpdb.org/pub/pdb/refdata/chem_comp/X/VPX/VPX.cif 
    6908 3vw7 title: 
    6909 Crystal structure of human protease-activated receptor 1 (PAR1) bound with
    6910 antagonist vorapaxar at 2.2 angstrom [more info...] 
    6911  
    6912 Chain information for 3vw7 #329 
    6913 --- 
    6914 Chain | Description | UniProt 
    6915 A | Proteinase-activated receptor 1, Lysozyme | PAR1_HUMAN 86-301 303-395, LYS_BPT4 1002-1161 
    6916  
    6917 Non-standard residues in 3vw7 #329 
    6918 --- 
    6919 CL — chloride ion 
    6920 NA — sodium ion 
    6921 OLC — (2R)-2,3-dihydroxypropyl (9Z)-octadec-9-enoate (1-Oleoyl-R-glycerol) 
    6922 VPX — ethyl
    6923 [(1R,3aR,4aR,6R,8aR,9S,9aS)-9-{(E)-2-[5-(3-fluorophenyl)pyridin-2-yl]ethenyl}-1-methyl-3-oxododecahydronaphtho[2,3-c]fur
    6924 an-6-yl]carbamate (vorapaxar) 
    6925  
    6926 3 atoms have alternate locations. Control/examine alternate locations with
    6927 Altloc Explorer [start tool...] or the altlocs command. 
    6928 3817 atoms have anisotropic B-factors. Depict anisotropic information with
    6929 Thermal Ellipsoids [start tool...] or the aniso command. 
    6930 Deleted 84 C-terminal residues, 207 N-terminal residues, 80 non-polymer
    6931 residues more than 3.0 Angstroms away. 
    6932 Alignment of 3vw7 chain A to query has RMSD 1.34 using 58 of 125 paired
    6933 residues within cutoff distance 2.0 
    6934 3c83 title: 
    6935 Bacteriophage T4 lysozyme mutant D89A in wildtype background at room
    6936 temperature [more info...] 
    6937  
    6938 Chain information for 3c83 #330 
    6939 --- 
    6940 Chain | Description | UniProt 
    6941 A | Lysozyme | LYS_BPT4 1-164 
    6942  
    6943 Non-standard residues in 3c83 #330 
    6944 --- 
    6945 BME — β-mercaptoethanol 
    6946 CL — chloride ion 
    6947  
    6948 18 atoms have alternate locations. Control/examine alternate locations with
    6949 Altloc Explorer [start tool...] or the altlocs command. 
    6950 Deleted 11 C-terminal residues, 2 N-terminal residues, 44 non-polymer residues
    6951 more than 3.0 Angstroms away. 
    6952 Alignment of 3c83 chain A to query has RMSD 0.962 using 47 of 125 paired
    6953 residues within cutoff distance 2.0 
    6954 2ou8 title: 
    6955 Structure of Spin-labeled T4 Lysozyme Mutant T115R1 at Room Temperature [more
    6956 info...] 
    6957  
    6958 Chain information for 2ou8 #331 
    6959 --- 
    6960 Chain | Description | UniProt 
    6961 A | Lysozyme | LYS_BPT4 1-164 
    6962  
    6963 Non-standard residues in 2ou8 #331 
    6964 --- 
    6965 BME — β-mercaptoethanol 
    6966 MTN — S-[(1-oxyl-2,2,5,5-tetramethyl-2,5-dihydro-1H-pyrrol-3-yl)methyl]
    6967 methanesulfonothioate (MTSL) 
    6968  
    6969 13 atoms have alternate locations. Control/examine alternate locations with
    6970 Altloc Explorer [start tool...] or the altlocs command. 
    6971 Deleted 11 C-terminal residues, 2 N-terminal residues, 46 non-polymer residues
    6972 more than 3.0 Angstroms away. 
    6973 Alignment of 2ou8 chain A to query has RMSD 1.01 using 48 of 125 paired
    6974 residues within cutoff distance 2.0 
    6975 1l91 title: 
    6976 Similar hydrophobic replacements of leu 99 and phe 153 within the core of T4
    6977 lysozyme have different structural and thermodynamic consequences [more
    6978 info...] 
    6979  
    6980 Chain information for 1l91 #332 
    6981 --- 
    6982 Chain | Description | UniProt 
    6983 A | T4 LYSOZYME | LYCV_BPT4 1-164 
    6984  
    6985 Non-standard residues in 1l91 #332 
    6986 --- 
    6987 BME — β-mercaptoethanol 
    6988 CL — chloride ion 
    6989  
    6990 Deleted 9 C-terminal residues, 2 N-terminal residues, 61 non-polymer residues
    6991 more than 3.0 Angstroms away. 
    6992 Alignment of 1l91 chain A to query has RMSD 1 using 48 of 125 paired residues
    6993 within cutoff distance 2.0 
    6994 1l76 title: 
    6995 Tolerance of T4 lysozyme to proline substitutions within the long interdomain
    6996 α-helix illustrates the adaptability of proteins to potentially destabilizing
    6997 lesions [more info...] 
    6998  
    6999 Chain information for 1l76 #333 
    7000 --- 
    7001 Chain | Description | UniProt 
    7002 A | LYSOZYME | LYS_BPT4 1-164 
    7003  
    7004 Non-standard residues in 1l76 #333 
    7005 --- 
    7006 BME — β-mercaptoethanol 
    7007 CL — chloride ion 
    7008  
    7009 Deleted 9 C-terminal residues, 2 N-terminal residues, 73 non-polymer residues
    7010 more than 3.0 Angstroms away. 
    7011 Alignment of 1l76 chain A to query has RMSD 0.95 using 44 of 124 paired
    7012 residues within cutoff distance 2.0 
    7013 1l24 title: 
    7014 Enhanced protein thermostability from site-directed mutations that decrease
    7015 the entropy of unfolding [more info...] 
    7016  
    7017 Chain information for 1l24 #334 
    7018 --- 
    7019 Chain | Description | UniProt 
    7020 A | T4 LYSOZYME | LYS_BPT4 1-164 
    7021  
    7022 Deleted 11 C-terminal residues, 2 N-terminal residues, 77 non-polymer residues
    7023 more than 3.0 Angstroms away. 
    7024 Alignment of 1l24 chain A to query has RMSD 1.05 using 50 of 125 paired
    7025 residues within cutoff distance 2.0 
    7026 228l title: 
    7027 Generating ligand binding sites In T4 lysozyme using deficiency-creating
    7028 substitutions [more info...] 
    7029  
    7030 Chain information for 228l #335 
    7031 --- 
    7032 Chain | Description | UniProt 
    7033 A | T4 LYSOZYME | LYCV_BPT4 1-164 
    7034  
    7035 Non-standard residues in 228l #335 
    7036 --- 
    7037 BME — β-mercaptoethanol 
    7038 CL — chloride ion 
    7039  
    7040 Deleted 9 C-terminal residues, 2 N-terminal residues, 57 non-polymer residues
    7041 more than 3.0 Angstroms away. 
    7042 Alignment of 228l chain A to query has RMSD 0.952 using 47 of 125 paired
    7043 residues within cutoff distance 2.0 
    7044 1xep title: 
    7045 Catechol in complex with T4 lysozyme L99A/M102Q [more info...] 
    7046  
    7047 Chain information for 1xep #336 
    7048 --- 
    7049 Chain | Description | UniProt 
    7050 A | Lysozyme | LYS_BPT4 1-164 
    7051  
    7052 Non-standard residues in 1xep #336 
    7053 --- 
    7054 BME — β-mercaptoethanol 
    7055 CAQ — catechol (1,2-dihydroxybenzene) 
    7056 PO4 — phosphate ion 
    7057  
    7058 80 atoms have alternate locations. Control/examine alternate locations with
    7059 Altloc Explorer [start tool...] or the altlocs command. 
    7060 Deleted 9 C-terminal residues, 2 N-terminal residues, 140 non-polymer residues
    7061 more than 3.0 Angstroms away. 
    7062 Alignment of 1xep chain A to query has RMSD 0.943 using 45 of 125 paired
    7063 residues within cutoff distance 2.0 
    7064 1l46 title: 
    7065 Cumulative site-directed charge-change replacements In bacteriophage T4
    7066 lysozyme suggest that long-range electrostatic interactions contribute little
    7067 to protein stability [more info...] 
    7068  
    7069 Chain information for 1l46 #337 
    7070 --- 
    7071 Chain | Description | UniProt 
    7072 A | T4 LYSOZYME | LYS_BPT4 1-164 
    7073  
    7074 Deleted 11 C-terminal residues, 2 N-terminal residues, 79 non-polymer residues
    7075 more than 3.0 Angstroms away. 
    7076 Alignment of 1l46 chain A to query has RMSD 0.981 using 47 of 127 paired
    7077 residues within cutoff distance 2.0 
    7078 1l20 title: 
    7079 Enhanced protein thermostability from designed mutations that interact with
    7080 α-helix dipoles [more info...] 
    7081  
    7082 Chain information for 1l20 #338 
    7083 --- 
    7084 Chain | Description | UniProt 
    7085 A | T4 LYSOZYME | LYS_BPT4 1-164 
    7086  
    7087 Deleted 11 C-terminal residues, 2 N-terminal residues, 71 non-polymer residues
    7088 more than 3.0 Angstroms away. 
    7089 Alignment of 1l20 chain A to query has RMSD 0.993 using 47 of 124 paired
    7090 residues within cutoff distance 2.0 
    7091 1l03 title: 
    7092 Contributions of hydrogen bonds of THR 157 to the thermodynamic stability of
    7093 phage T4 lysozyme [more info...] 
    7094  
    7095 Chain information for 1l03 #339 
    7096 --- 
    7097 Chain | Description | UniProt 
    7098 A | T4 LYSOZYME | LYS_BPT4 1-164 
    7099  
    7100 Non-standard residues in 1l03 #339 
    7101 --- 
    7102 BME — β-mercaptoethanol 
    7103  
    7104 Deleted 11 C-terminal residues, 2 N-terminal residues, 70 non-polymer residues
    7105 more than 3.0 Angstroms away. 
    7106 Alignment of 1l03 chain A to query has RMSD 1.03 using 49 of 125 paired
    7107 residues within cutoff distance 2.0 
    7108 1dyg title: 
    7109 Determination of α-helix propensity within the context of A folded protein:
    7110 sites 44 and 131 In bacteriophage T4 lysozyme [more info...] 
    7111  
    7112 Chain information for 1dyg #340 
    7113 --- 
    7114 Chain | Description | UniProt 
    7115 A | T4 LYSOZYME | LYS_BPT4 1-164 
    7116  
    7117 Non-standard residues in 1dyg #340 
    7118 --- 
    7119 BME — β-mercaptoethanol 
    7120 CL — chloride ion 
     1511[deleted to fit within ticket limits]
     1512
    71211513 
    71221514Deleted 9 C-terminal residues, 2 N-terminal residues, 75 non-polymer residues