Opened 6 years ago
Last modified 6 years ago
#3985 accepted defect
Modeller: UnboundLocalError: local variable 'target_name'
| Reported by: | Owned by: | Eric Pettersen | |
|---|---|---|---|
| Priority: | normal | Milestone: | |
| Component: | Sequence | Version: | |
| Keywords: | Cc: | ||
| Blocked By: | Blocking: | ||
| Notify when closed: | Platform: | all | |
| Project: | ChimeraX |
Description
The following bug report has been submitted:
Platform: macOS-10.15.7-x86_64-i386-64bit
ChimeraX Version: 1.2.dev202011130655 (2020-11-13 06:55:07 UTC)
Description
Trying to run modeller using uniprot fetched sequence oprd_human and 4kdl as a template that I associated with the sequence.
Log:
UCSF ChimeraX version: 1.2.dev202011130655 (2020-11-13)
© 2016-2020 Regents of the University of California. All rights reserved.
How to cite UCSF ChimeraX
> open oprd_human fromDatabase uniprot
Summary of feedback from opening oprd_human fetched from uniprot
---
note | Alignment identifier is oprd_human
Opened UniProt oprd_human
> open 4dkl
4dkl title:
Crystal structure of the mu-opioid receptor bound to a morphinan antagonist
[more info...]
Chain information for 4dkl #1
---
Chain | Description
A | Mu-type opioid receptor, lysozyme chimera
Non-standard residues in 4dkl #1
---
1PE — pentaethylene glycol (PEG400)
BF0 — methyl
4-{[(5beta,6alpha)-17-(cyclopropylmethyl)-3,14-dihydroxy-4,5-epoxymorphinan-6-yl]amino}-4-oxobutanoate
(beta-funaltrexamine, bound form)
CL — chloride ion
CLR — cholesterol
MPG — [(Z)-octadec-9-enyl] (2R)-2,3-bis(oxidanyl)propanoate
SO4 — sulfate ion
4dkl mmCIF Assemblies
---
1| author_and_software_defined_assembly
> sequence associate /A oprd_human:1
Associated 4dkl chain A to oprd_human with 166 mismatches and/or gaps
> ui tool show "Modeller Comparative"
Traceback (most recent call last):
File "/Users/goddard/ucsf/chimerax-
pyside/ChimeraX.app/Contents/Library/Frameworks/Python.framework/Versions/3.8/lib/python3.8/site-
packages/chimerax/seq-view/tool.py", line 515, in <lambda>
% (fmt.nicknames[0], StringArg.unparse(self.alignment.ident))))
AttributeError: 'bool' object has no attribute 'nicknames'
AttributeError: 'bool' object has no attribute 'nicknames'
File "/Users/goddard/ucsf/chimerax-
pyside/ChimeraX.app/Contents/Library/Frameworks/Python.framework/Versions/3.8/lib/python3.8/site-
packages/chimerax/seq-view/tool.py", line 515, in
% (fmt.nicknames[0], StringArg.unparse(self.alignment.ident))))
See log for complete Python traceback.
> modeller comparative oprd_human:1 multichain true numModels 5 fast false
> hetPreserve false hydrogens false waterPreserve false
No Modeller license key provided. Get a license key by registering at the
Modeller web site.
> modeller comparative oprd_human:1 multichain true numModels 5 fast false
> hetPreserve false hydrogens false waterPreserve false
No Modeller license key provided. Get a license key by registering at the
Modeller web site.
> modeller comparative oprd_human:1 multichain true numModels 5 fast false
> hetPreserve false hydrogens false waterPreserve false
Web Service: Modeller9v8 is a Python wrapper that calls Modeller (v9.18) for
protein structure modeling
Opal service URL:
http://webservices.rbvi.ucsf.edu/opal2/services/Modeller9v8Service
Opal job id: appModeller9v8Service1606366360648-2101771674
Opal status URL prefix:
http://webservices.rbvi.ucsf.edu/appModeller9v8Service1606366360648-2101771674
stdout.txt = standard output
stderr.txt = standard error
Modeller job ID appModeller9v8Service1606366360648-2101771674 finished
Modeller error output
Traceback (most recent call last):
File "/usr/local/opal-local/bin/modeller9v8.py", line 322, in <module>
main()
File "/usr/local/opal-local/bin/modeller9v8.py", line 24, in main
VersionMap[cf["version"]](cf)
File "/usr/local/opal-local/bin/modeller9v8.py", line 34, in v2_run
execfile(fn)
File "ModellerModelling.py", line 67, in <module>
a.make()
File "/usr/lib64/python2.7/site-packages/modeller/automodel/automodel.py",
line 133, in make
self.homcsr(exit_stage)
File "/usr/lib64/python2.7/site-packages/modeller/automodel/automodel.py",
line 595, in homcsr
aln = self.read_alignment()
File "/usr/lib64/python2.7/site-packages/modeller/automodel/automodel.py",
line 556, in read_alignment
aln.append(file=self.alnfile, align_codes=codes)
File "/usr/lib64/python2.7/site-packages/modeller/alignment.py", line 80, in
append
allow_alternates)
_modeller.SequenceMismatchError: get_ran_648E> Alignment sequence does not
match that in PDB file: 1 ./4dkl_1.pdb (You didn't specify the starting and
ending residue numbers and chain IDs in the alignment, so Modeller tried to
guess these from the PDB file.) Suggestion: put in the residue numbers and
chain IDs (see the manual) and run again for more detailed diagnostics. You
could also try running with allow_alternates=True to accept alternate one-
letter code matches (e.g. B to N, Z to Q).
Modeller run output
MODELLER 9.22, 2019/06/19, r11413
PROTEIN STRUCTURE MODELLING BY SATISFACTION OF SPATIAL RESTRAINTS
Copyright(c) 1989-2019 Andrej Sali
All Rights Reserved
Written by A. Sali
with help from
B. Webb, M.S. Madhusudhan, M-Y. Shen, G.Q. Dong,
M.A. Marti-Renom, N. Eswar, F. Alber, M. Topf, B. Oliva,
A. Fiser, R. Sanchez, B. Yerkovich, A. Badretdinov,
F. Melo, J.P. Overington, E. Feyfant
University of California, San Francisco, USA
Rockefeller University, New York, USA
Harvard University, Cambridge, USA
Imperial Cancer Research Fund, London, UK
Birkbeck College, University of London, London, UK
Kind, OS, HostName, Kernel, Processor: 4, Linux watson.cgl.ucsf.edu
3.10.0-1127.19.1.el7.x86_64 x86_64
Date and time of compilation : 2019/06/19 14:00:54
MODELLER executable type : x86_64-intel8
Job starting time (YY/MM/DD HH:MM:SS): 2020/11/25 20:52:40
openf___224_> Open $(LIB)/restyp.lib
openf___224_> Open ${MODINSTALL9v22}/modlib/resgrp.lib
rdresgr_266_> Number of residue groups: 2
openf___224_> Open ${MODINSTALL9v22}/modlib/sstruc.lib
Dynamically allocated memory at amaxlibraries [B,KiB,MiB]: 191566 187.076
0.183
Dynamically allocated memory at amaxlibraries [B,KiB,MiB]: 192094 187.592
0.183
openf___224_> Open ${MODINSTALL9v22}/modlib/resdih.lib
Dynamically allocated memory at amaxlibraries [B,KiB,MiB]: 240694 235.053
0.230
rdrdih__263_> Number of dihedral angle types : 9
Maximal number of dihedral angle optima: 3
Dihedral angle names : Alph Phi Psi Omeg chi1 chi2 chi3 chi4 chi5
openf___224_> Open ${MODINSTALL9v22}/modlib/radii.lib
Dynamically allocated memory at amaxlibraries [B,KiB,MiB]: 253994 248.041
0.242
openf___224_> Open ${MODINSTALL9v22}/modlib/radii14.lib
openf___224_> Open ${MODINSTALL9v22}/modlib/af_mnchdef.lib
rdwilmo_274_> Mainchain residue conformation classes: APBLE
openf___224_> Open ${MODINSTALL9v22}/modlib/mnch.lib
rdclass_257_> Number of classes: 5
openf___224_> Open ${MODINSTALL9v22}/modlib/mnch1.lib
openf___224_> Open ${MODINSTALL9v22}/modlib/mnch2.lib
openf___224_> Open ${MODINSTALL9v22}/modlib/mnch3.lib
openf___224_> Open ${MODINSTALL9v22}/modlib/xs4.mat
rdrrwgh_268_> Number of residue types: 21
openf___224_> Open alignment.ali
Dynamically allocated memory at amaxalignment [B,KiB,MiB]: 269801 263.478
0.257
Dynamically allocated memory at amaxalignment [B,KiB,MiB]: 284893 278.216
0.272
Dynamically allocated memory at amaxalignment [B,KiB,MiB]: 300293 293.255
0.286
Dynamically allocated memory at amaxalignment [B,KiB,MiB]: 331093 323.333
0.316
Dynamically allocated memory at amaxalignment [B,KiB,MiB]: 392693 383.489
0.375
openf___224_> Open ./4dkl_1.pdb
Dynamically allocated memory at amaxalignment [B,KiB,MiB]: 402241 392.813
0.384
Dynamically allocated memory at amaxalignment [B,KiB,MiB]: 411789 402.138
0.393
get_ran_648E> Alignment sequence does not match that in PDB file: 1
./4dkl_1.pdb
(You didn't specify the starting and ending residue numbers and
chain IDs in the alignment, so Modeller tried to guess these from
the PDB file.)
Suggestion: put in the residue numbers and chain IDs (see the
manual) and run again for more detailed diagnostics.
You could also try running with allow_alternates=True to accept
alternate one-letter code matches (e.g. B to N, Z to Q).
Alignment sequence:
MVTAITIMALYSIVCVVGLFGNFLVMYVIVRYTKMKTATNIYIFNLALADALATSTLPFQSVNYLMGTWPFGNIL
CKIVISIDYYNMFTSIFTLCTMSVDRYIAVCHPVKALDFRTPRNAKIVNVCNWILSSAIGLPVMFMATTKYRQGS
IDCTLTFSHPTWYWENLLKICVFIFAFIMPVLIITVCYGLMILRLKSVRGTWDAYEKDRNLRRITRMVLVVVAVF
IVCWTPIHIYVIIKALITIPETTFQTVSWHFCIALGYTNSCLNPVLYAFLDENFKRCFREFCI
PDB sequence matching range provided in alignment:
MVTAITIMALYSIVCVVGLFGNFLVMYVIVRYTKMKTATNIYIFNLALADALATSTLPFQSVNYLMGTWPFGNIL
CKIVISIDYYNMFTSIFTLCTMSVDRYIAVCHPVKALDFRTPRNAKIVNVCNWILSSAIGLPVMFMATTKYRQGS
IDCTLTFSHPTWYWENLLKICVFIFAFIMPVLIITVCYGLMILRLKSVRNIFEMLRIDEGLRLKIYKNTEGYYTI
GIGHLLTKSPSLNAAKSELDKAIGRNTNGVITKDEAEKLFNQDVDAAVRGILRNAKLKPVYDSLDAVRRAALINM
VFQMGETGVAGFTNSLRMLQQKRWDEAAVNLAKSRWYNQTPNRAKRVITTFRTGTWDAYEKDRNLRRITRMVLVV
VAVFIVCWTPIHIYVIIKALITIPETTFQTVSWHFCIALGYTNSCLNPVLYAFLDENFKRCFREFCI
No output models from Modeller; see log for Modeller text output.
> ui tool show "Modeller Comparative"
> ui tool show "Modeller Comparative"
> modeller comparative oprd_human:1 multichain false numModels 5 fast false
> hetPreserve false hydrogens false waterPreserve false
Traceback (most recent call last):
File "/Users/goddard/ucsf/chimerax-
pyside/ChimeraX.app/Contents/Library/Frameworks/Python.framework/Versions/3.8/lib/python3.8/site-
packages/chimerax/modeller/tool.py", line 140, in launch_modeller
run(self.session, "modeller comparative %s multichain %s numModels %d fast %s
hetPreserve %s"
File "/Users/goddard/ucsf/chimerax-
pyside/ChimeraX.app/Contents/Library/Frameworks/Python.framework/Versions/3.8/lib/python3.8/site-
packages/chimerax/core/commands/run.py", line 36, in run
results = command.run(text, log=log, return_json=return_json)
File "/Users/goddard/ucsf/chimerax-
pyside/ChimeraX.app/Contents/Library/Frameworks/Python.framework/Versions/3.8/lib/python3.8/site-
packages/chimerax/core/commands/cli.py", line 2835, in run
result = ci.function(session, **kw_args)
File "/Users/goddard/ucsf/chimerax-
pyside/ChimeraX.app/Contents/Library/Frameworks/Python.framework/Versions/3.8/lib/python3.8/site-
packages/chimerax/modeller/cmd.py", line 34, in sequence_model
comparative.model(session, targets, block=block, multichain=multichain,
File "/Users/goddard/ucsf/chimerax-
pyside/ChimeraX.app/Contents/Library/Frameworks/Python.framework/Versions/3.8/lib/python3.8/site-
packages/chimerax/modeller/comparative.py", line 215, in model
pir_target = Sequence(name=target_name)
UnboundLocalError: local variable 'target_name' referenced before assignment
UnboundLocalError: local variable 'target_name' referenced before assignment
File "/Users/goddard/ucsf/chimerax-
pyside/ChimeraX.app/Contents/Library/Frameworks/Python.framework/Versions/3.8/lib/python3.8/site-
packages/chimerax/modeller/comparative.py", line 215, in model
pir_target = Sequence(name=target_name)
See log for complete Python traceback.
OpenGL version: 4.1 ATI-3.10.18
OpenGL renderer: AMD Radeon Pro Vega 20 OpenGL Engine
OpenGL vendor: ATI Technologies Inc.Hardware:
Hardware Overview:
Model Name: MacBook Pro
Model Identifier: MacBookPro15,3
Processor Name: 8-Core Intel Core i9
Processor Speed: 2.4 GHz
Number of Processors: 1
Total Number of Cores: 8
L2 Cache (per Core): 256 KB
L3 Cache: 16 MB
Hyper-Threading Technology: Enabled
Memory: 32 GB
Boot ROM Version: 1037.147.4.0.0 (iBridge: 17.16.16610.0.0,0)
Software:
System Software Overview:
System Version: macOS 10.15.7 (19H2)
Kernel Version: Darwin 19.6.0
Time since boot: 13 days 5:04
Graphics/Displays:
Intel UHD Graphics 630:
Chipset Model: Intel UHD Graphics 630
Type: GPU
Bus: Built-In
VRAM (Dynamic, Max): 1536 MB
Vendor: Intel
Device ID: 0x3e9b
Revision ID: 0x0002
Automatic Graphics Switching: Supported
gMux Version: 5.0.0
Metal: Supported, feature set macOS GPUFamily2 v1
Radeon Pro Vega 20:
Chipset Model: Radeon Pro Vega 20
Type: GPU
Bus: PCIe
PCIe Lane Width: x8
VRAM (Total): 4 GB
Vendor: AMD (0x1002)
Device ID: 0x69af
Revision ID: 0x00c0
ROM Revision: 113-D2060I-087
VBIOS Version: 113-D20601MA0T-016
Option ROM Version: 113-D20601MA0T-016
EFI Driver Version: 01.01.087
Automatic Graphics Switching: Supported
gMux Version: 5.0.0
Metal: Supported, feature set macOS GPUFamily2 v1
Displays:
Color LCD:
Display Type: Built-In Retina LCD
Resolution: 2880 x 1800 Retina
Framebuffer Depth: 24-Bit Color (ARGB8888)
Main Display: Yes
Mirror: Off
Online: Yes
Automatically Adjust Brightness: No
Connection Type: Internal
Locale: ('en_US', 'UTF-8')
PyQt version: 5.15.1
Compiled Qt version: 5.15.1
Installed Packages:
alabaster: 0.7.12
appdirs: 1.4.4
appnope: 0.1.0
Babel: 2.9.0
backcall: 0.2.0
blockdiag: 2.0.1
certifi: 2020.11.8
cftime: 1.2.1
chardet: 3.0.4
ChimeraX-AddH: 2.1.3
ChimeraX-AlignmentAlgorithms: 2.0
ChimeraX-AlignmentHdrs: 3.2
ChimeraX-AlignmentMatrices: 2.0
ChimeraX-Alignments: 2.1
ChimeraX-Arrays: 1.0
ChimeraX-Atomic: 1.9.3
ChimeraX-AtomicLibrary: 1.1
ChimeraX-AtomSearch: 2.0
ChimeraX-AtomSearchLibrary: 1.0
ChimeraX-AxesPlanes: 2.0
ChimeraX-BasicActions: 1.1
ChimeraX-BILD: 1.0
ChimeraX-BlastProtein: 1.1
ChimeraX-BondRot: 2.0
ChimeraX-BugReporter: 1.0
ChimeraX-BuildStructure: 2.2
ChimeraX-Bumps: 1.0
ChimeraX-BundleBuilder: 1.0
ChimeraX-ButtonPanel: 1.0
ChimeraX-CageBuilder: 1.0
ChimeraX-CellPack: 1.0
ChimeraX-Centroids: 1.1
ChimeraX-ChemGroup: 2.0
ChimeraX-Clashes: 2.1
ChimeraX-ColorActions: 1.0
ChimeraX-ColorGlobe: 1.0
ChimeraX-CommandLine: 1.1.3
ChimeraX-ConnectStructure: 2.0
ChimeraX-Contacts: 1.0
ChimeraX-Core: 1.2.dev202011130655
ChimeraX-CoreFormats: 1.0
ChimeraX-coulombic: 1.0.1
ChimeraX-Crosslinks: 1.0
ChimeraX-Crystal: 1.0
ChimeraX-DataFormats: 1.0.1
ChimeraX-Dicom: 1.0
ChimeraX-DistMonitor: 1.1
ChimeraX-DistUI: 1.0
ChimeraX-Dssp: 2.0
ChimeraX-EMDB-SFF: 1.0
ChimeraX-ExperimentalCommands: 1.0
ChimeraX-FileHistory: 1.0
ChimeraX-FunctionKey: 1.0
ChimeraX-Geometry: 1.1
ChimeraX-gltf: 1.0
ChimeraX-Graphics: 1.0
ChimeraX-Hbonds: 2.1
ChimeraX-Help: 1.0
ChimeraX-HKCage: 1.3
ChimeraX-IHM: 1.0
ChimeraX-ImageFormats: 1.1
ChimeraX-IMOD: 1.0
ChimeraX-IO: 1.0
ChimeraX-Label: 1.0
ChimeraX-ListInfo: 1.1
ChimeraX-Log: 1.1.1
ChimeraX-LookingGlass: 1.1
ChimeraX-Map: 1.0.1
ChimeraX-MapData: 2.0
ChimeraX-MapEraser: 1.0
ChimeraX-MapFilter: 2.0
ChimeraX-MapFit: 2.0
ChimeraX-MapSeries: 2.0
ChimeraX-Markers: 1.0
ChimeraX-Mask: 1.0
ChimeraX-MatchMaker: 1.1
ChimeraX-MDcrds: 2.1
ChimeraX-MedicalToolbar: 1.0.1
ChimeraX-Meeting: 1.0
ChimeraX-MLP: 1.0
ChimeraX-mmCIF: 2.2
ChimeraX-MMTF: 2.0
ChimeraX-Modeller: 1.0
ChimeraX-ModelPanel: 1.0
ChimeraX-ModelSeries: 1.0
ChimeraX-Mol2: 2.0
ChimeraX-Morph: 1.0
ChimeraX-MouseModes: 1.0
ChimeraX-Movie: 1.0
ChimeraX-Neuron: 1.0
ChimeraX-Nucleotides: 2.0
ChimeraX-OpenCommand: 1.3.1
ChimeraX-PDB: 2.2
ChimeraX-PDBBio: 1.0
ChimeraX-PDBLibrary: 1.0
ChimeraX-PickBlobs: 1.0
ChimeraX-Positions: 1.0
ChimeraX-PresetMgr: 1.0.1
ChimeraX-PubChem: 2.0.1
ChimeraX-Read-Pbonds: 1.0
ChimeraX-Registration: 1.1
ChimeraX-RemoteControl: 1.0
ChimeraX-ResidueFit: 1.0
ChimeraX-RestServer: 1.1
ChimeraX-RNALayout: 1.0
ChimeraX-RotamerLibMgr: 2.0
ChimeraX-RotamerLibsDunbrack: 2.0
ChimeraX-RotamerLibsDynameomics: 2.0
ChimeraX-RotamerLibsRichardson: 2.0
ChimeraX-SaveCommand: 1.2.1
ChimeraX-SchemeMgr: 1.0
ChimeraX-SDF: 2.0
ChimeraX-Segger: 1.0
ChimeraX-Segment: 1.0
ChimeraX-SeqView: 2.2.1
ChimeraX-Shape: 1.0.1
ChimeraX-Shell: 1.0
ChimeraX-Shortcuts: 1.0
ChimeraX-ShowAttr: 1.0
ChimeraX-ShowSequences: 1.0
ChimeraX-SideView: 1.0
ChimeraX-Smiles: 2.0.1
ChimeraX-SmoothLines: 1.0
ChimeraX-SpaceNavigator: 1.0
ChimeraX-StdCommands: 1.2.2
ChimeraX-STL: 1.0
ChimeraX-Storm: 1.0
ChimeraX-Struts: 1.0
ChimeraX-Surface: 1.0
ChimeraX-SwapAA: 2.0
ChimeraX-SwapRes: 2.0
ChimeraX-TapeMeasure: 1.0
ChimeraX-Test: 1.0
ChimeraX-Toolbar: 1.0
ChimeraX-ToolshedUtils: 1.0
ChimeraX-Tug: 1.0
ChimeraX-UI: 1.3.1
ChimeraX-uniprot: 2.0
ChimeraX-ViewDockX: 1.0
ChimeraX-Vive: 1.1
ChimeraX-VolumeMenu: 1.0
ChimeraX-VTK: 1.0
ChimeraX-WavefrontOBJ: 1.0
ChimeraX-WebCam: 1.0
ChimeraX-WebServices: 1.0
ChimeraX-Zone: 1.0
colorama: 0.4.3
comtypes: 1.1.7
cxservices: 1.0
cycler: 0.10.0
Cython: 0.29.21
decorator: 4.4.2
distlib: 0.3.1
docutils: 0.16
filelock: 3.0.12
funcparserlib: 0.3.6
grako: 3.16.5
h5py: 2.10.0
html2text: 2020.1.16
idna: 2.10
ihm: 0.17
imagecodecs: 2020.5.30
imagecodecs-lite: 2020.1.31
imagesize: 1.2.0
ipykernel: 5.3.4
ipython: 7.18.1
ipython-genutils: 0.2.0
jedi: 0.17.2
Jinja2: 2.11.2
jupyter-client: 6.1.7
jupyter-core: 4.6.3
kiwisolver: 1.3.1
line-profiler: 2.1.2
lxml: 4.5.2
lz4: 3.1.0
MarkupSafe: 1.1.1
matplotlib: 3.3.2
MolecularDynamicsViewer: 1.1
msgpack: 1.0.0
netCDF4: 1.5.4
netifaces: 0.10.9
networkx: 2.5
numexpr: 2.7.1
numpy: 1.19.2
numpydoc: 1.1.0
openvr: 1.14.1501
packaging: 20.4
parso: 0.7.1
pexpect: 4.8.0
pickleshare: 0.7.5
Pillow: 7.2.0
pip: 20.2.3
pkginfo: 1.5.0.1
prompt-toolkit: 3.0.8
psutil: 5.7.2
ptyprocess: 0.6.0
pycollada: 0.7.1
pydicom: 2.0.0
Pygments: 2.7.1
PyOpenGL: 3.1.5
PyOpenGL-accelerate: 3.1.5
pyparsing: 2.4.7
PySide2: 5.15.1
python-dateutil: 2.8.1
pytz: 2020.4
pyzmq: 19.0.2
qtconsole: 4.7.7
QtPy: 1.9.0
RandomWords: 0.3.0
requests: 2.24.0
scipy: 1.5.2
Send2Trash: 1.5.0
setuptools: 50.3.0
sfftk-rw: 0.6.7.dev1
shiboken2: 5.15.1
six: 1.15.0
snowballstemmer: 2.0.0
sortedcontainers: 2.2.2
Sphinx: 3.2.1
sphinxcontrib-applehelp: 1.0.2
sphinxcontrib-blockdiag: 2.0.0
sphinxcontrib-devhelp: 1.0.2
sphinxcontrib-htmlhelp: 1.0.3
sphinxcontrib-jsmath: 1.0.1
sphinxcontrib-qthelp: 1.0.3
sphinxcontrib-serializinghtml: 1.1.4
suds-jurko: 0.6
tables: 3.6.1
tifffile: 2020.9.3
tinyarray: 1.2.3
tornado: 6.1
traitlets: 5.0.5
urllib3: 1.25.11
wcwidth: 0.2.5
webcolors: 1.11.1
wheel: 0.35.1
Change History (8)
comment:2 by , 6 years ago
| Component: | Unassigned → Sequence |
|---|---|
| Owner: | set to |
| Platform: | → all |
| Project: | → ChimeraX |
| Status: | new → assigned |
| Summary: | ChimeraX bug report submission → Modeller: UnboundLocalError: local variable 'target_name' |
comment:3 by , 6 years ago
| Status: | assigned → accepted |
|---|
comment:4 by , 6 years ago
comment:6 by , 6 years ago
Have committed.a fix for this problem as exhibited by my sequence-alignment test case.
comment:7 by , 6 years ago
Need to wait for UniProt to come "back online" to verify that the problems in the ticket are also resolved.
comment:8 by , 6 years ago
The fix isn't sufficient to get the case in this ticket to work (though undoubtedly also necessary). So, needs more work...
Note:
See TracTickets
for help on using tickets.