Opened 5 years ago
Closed 5 years ago
#5873 closed defect (duplicate)
Dual display problem
| Reported by: | Owned by: | Tom Goddard | |
|---|---|---|---|
| Priority: | normal | Milestone: | |
| Component: | Window Toolkit | Version: | |
| Keywords: | Cc: | ||
| Blocked By: | Blocking: | ||
| Notify when closed: | Platform: | all | |
| Project: | ChimeraX |
Description
The following bug report has been submitted:
Platform: macOS-10.15.7-x86_64-i386-64bit
ChimeraX Version: 1.2.5 (2021-05-24 04:13:57 UTC)
Description
(Describe the actions that caused this problem to occur here)
Log:
UCSF ChimeraX version: 1.2.5 (2021-05-24)
© 2016-2021 Regents of the University of California. All rights reserved.
> open "/Users/aks3233/Desktop/Str_modeling/35K linker.cxs" format session
Log from Wed Dec 22 14:55:57 2021UCSF ChimeraX version: 1.2.5 (2021-05-24)
© 2016-2021 Regents of the University of California. All rights reserved.
How to cite UCSF ChimeraX
> open
> /Users/aks3233/Box/MMTV/SP_59_61_b24d1.result/MMTVSPMutant5961_b24d1_unrelaxed_model_1.pdb
> format pdb
Chain information for MMTVSPMutant5961_b24d1_unrelaxed_model_1.pdb #1
---
Chain | Description
A | No description available
> open
> /Users/aks3233/Desktop/Str_modeling/UBL_YFP_35K_T7pep_35K_BFP_80796.result/UBL_YFP_35K_T7pep_35K_BFP_80796_unrelaxed_rank_1_model_4.pdb
Chain information for
UBL_YFP_35K_T7pep_35K_BFP_80796_unrelaxed_rank_1_model_4.pdb #2
---
Chain | Description
A | No description available
> sequence chain #1/A
Alignment identifier is 1/A
> hide #1 models
> hide #1 target m
> hide #1 target m
> close #1
> sequence chain #2/A
Alignment identifier is 2/A
> open
> /Users/aks3233/Desktop/Str_modeling/2A_9d63a.result/2A_9d63a_unrelaxed_rank_5_model_1.pdb
Chain information for 2A_9d63a_unrelaxed_rank_5_model_1.pdb #1
---
Chain | Description
A | No description available
> hide #1 models
> open
> /Users/aks3233/Desktop/Str_modeling/m2_29515.result/m2_29515_unrelaxed_rank_4_model_1.pdb
Chain information for m2_29515_unrelaxed_rank_4_model_1.pdb #3
---
Chain | Description
A | No description available
> hide #3 models
> open
> /Users/aks3233/Desktop/Str_modeling/m2_70726.result/m2_70726_unrelaxed_rank_1_model_5.pdb
Chain information for m2_70726_unrelaxed_rank_1_model_5.pdb #4
---
Chain | Description
A | No description available
> hide #4 models
> open
> /Users/aks3233/Desktop/Str_modeling/UBL_YFP_M0_T7pep_M0_BFP_198ce.result/UBL_YFP_M0_T7pep_M0_BFP_198ce_unrelaxed_rank_1_model_3.pdb
Chain information for
UBL_YFP_M0_T7pep_M0_BFP_198ce_unrelaxed_rank_1_model_3.pdb #5
---
Chain | Description
A | No description available
> hide #5 models
> hide #2 models
> show #2 models
> show #2 target m
> select #2
5311 atoms, 5417 bonds, 680 residues, 1 model selected
> ~select #2
Nothing selected
> select #3
4918 atoms, 5018 bonds, 639 residues, 1 model selected
> ~select #3
Nothing selected
> select #2/A:76
9 atoms, 8 bonds, 1 residue, 1 model selected
> select #2/A:1-76
593 atoms, 598 bonds, 76 residues, 1 model selected
> color sel orange
> select clear
> select #2/A:86-87
15 atoms, 14 bonds, 2 residues, 1 model selected
> select #2/A:86-92
52 atoms, 51 bonds, 7 residues, 1 model selected
> select #2/A:86-89
30 atoms, 29 bonds, 4 residues, 1 model selected
> select #2/A:86-242
1239 atoms, 1266 bonds, 157 residues, 1 model selected
> select #2/A:243-244
18 atoms, 17 bonds, 2 residues, 1 model selected
> select #2/A:243-248
47 atoms, 46 bonds, 6 residues, 1 model selected
> select #2/A:86
8 atoms, 7 bonds, 1 residue, 1 model selected
> select #2/A:86-229
1132 atoms, 1156 bonds, 144 residues, 1 model selected
> select #2/A:316-317
17 atoms, 17 bonds, 2 residues, 1 model selected
> select #2/A:310-317
53 atoms, 53 bonds, 8 residues, 1 model selected
> select
> #2/A:2-7,13-18,42-45,67-72,97-108,111-122,127-134,178-186,191-201,204-214,234-241,246-256,262-273,285-294,303-313,456-466,469-480,485-494,535-543,548-558,561-571,590-597,600-610,616-627,640-652,657-667
2089 atoms, 2105 bonds, 256 residues, 1 model selected
> select clear
> select #2/A:323-324
21 atoms, 21 bonds, 2 residues, 1 model selected
> select #2/A:312-324
97 atoms, 98 bonds, 13 residues, 1 model selected
> select
> #2/A:2-7,13-18,42-45,67-72,97-108,111-122,127-134,178-186,191-201,204-214,234-241,246-256,262-273,285-294,303-313,456-466,469-480,485-494,535-543,548-558,561-571,590-597,600-610,616-627,640-652,657-667
2089 atoms, 2105 bonds, 256 residues, 1 model selected
> select clear
> select #2/A:300
9 atoms, 8 bonds, 1 residue, 1 model selected
> select #2/A:296-300
41 atoms, 41 bonds, 5 residues, 1 model selected
> select #2/A:324
9 atoms, 8 bonds, 1 residue, 1 model selected
> select #2/A:86-324
1891 atoms, 1933 bonds, 239 residues, 1 model selected
> color sel forest green
> select #2/A:448
8 atoms, 7 bonds, 1 residue, 1 model selected
> select #2/A:448-680
1848 atoms, 1891 bonds, 233 residues, 1 model selected
> color sel blue
> select clear
> save "/Users/aks3233/Desktop/Str_modeling/35K linker.cxs"
——— End of log from Wed Dec 22 14:55:57 2021 ———
opened ChimeraX session
> close
> open
> /Users/aks3233/Desktop/Str_modeling/UBL_YFP_35K_T7pep_35K_BFP_80796.result/UBL_YFP_35K_T7pep_35K_BFP_80796_unrelaxed_rank_1_model_4.pdb
Chain information for
UBL_YFP_35K_T7pep_35K_BFP_80796_unrelaxed_rank_1_model_4.pdb #1
---
Chain | Description
A | No description available
> select /A:1-680
5311 atoms, 5417 bonds, 680 residues, 1 model selected
> show target m
> sequence chain #1/A
Alignment identifier is 1/A
> open
> /Users/aks3233/Desktop/Str_modeling/UBL_YFP_M0_T7pep_M0_BFP_198ce.result/UBL_YFP_M0_T7pep_M0_BFP_198ce_unrelaxed_rank_1_model_3.pdb
Chain information for
UBL_YFP_M0_T7pep_M0_BFP_198ce_unrelaxed_rank_1_model_3.pdb #2
---
Chain | Description
A | No description available
> open
> /Users/aks3233/Desktop/Str_modeling/2A_9d63a.result/2A_9d63a_unrelaxed_rank_1_model_5.pdb
Chain information for 2A_9d63a_unrelaxed_rank_1_model_5.pdb #3
---
Chain | Description
A | No description available
> open
> /Users/aks3233/Desktop/Str_modeling/m2_29515.result/m2_29515_unrelaxed_rank_4_model_1.pdb
Chain information for m2_29515_unrelaxed_rank_4_model_1.pdb #4
---
Chain | Description
A | No description available
> open
> /Users/aks3233/Desktop/Str_modeling/m2_70726.result/m2_70726_unrelaxed_rank_4_model_1.pdb
Chain information for m2_70726_unrelaxed_rank_4_model_1.pdb #5
---
Chain | Description
A | No description available
> hide #5 models
> hide #4 models
> hide #3 models
> hide #2 models
> ~select #1
Nothing selected
> MVSLTFKNFKKEKVPLDLEPSNTILETKTKLAQSISCEESQIKLIYSGKVLQDSKTVSECGLKDGDQVVFMVSQKK
Unknown command:
MVSLTFKNFKKEKVPLDLEPSNTILETKTKLAQSISCEESQIKLIYSGKVLQDSKTVSECGLKDGDQVVFMVSQKK
> select
> #1/A:2-7,13-18,42-45,67-72,97-108,111-122,127-134,178-186,191-201,204-214,234-241,246-256,262-273,285-294,303-313,456-466,469-480,485-494,535-543,548-558,561-571,590-597,600-610,616-627,640-652,657-667
2089 atoms, 2105 bonds, 256 residues, 1 model selected
> select #1/A:141-151
83 atoms, 86 bonds, 11 residues, 1 model selected
> select #1/A:106-141
259 atoms, 261 bonds, 36 residues, 1 model selected
> select #1/A:1
8 atoms, 7 bonds, 1 residue, 1 model selected
> select #1/A:1-76
593 atoms, 598 bonds, 76 residues, 1 model selected
> color sel red
> select #1/A:86-87
15 atoms, 14 bonds, 2 residues, 1 model selected
> select #1/A:86-88
21 atoms, 20 bonds, 3 residues, 1 model selected
> select #1/A:86-87
15 atoms, 14 bonds, 2 residues, 1 model selected
> select #1/A:86-344
2044 atoms, 2088 bonds, 259 residues, 1 model selected
> select #1/A:277
4 atoms, 3 bonds, 1 residue, 1 model selected
> select #1/A:262-277
123 atoms, 125 bonds, 16 residues, 1 model selected
> select #1/A:314
4 atoms, 3 bonds, 1 residue, 1 model selected
> select #1/A:287-314
222 atoms, 225 bonds, 28 residues, 1 model selected
> select #1/A:324
9 atoms, 8 bonds, 1 residue, 1 model selected
> select #1/A:86-324
1891 atoms, 1933 bonds, 239 residues, 1 model selected
> color sel forest green
> select #1/A:448
8 atoms, 7 bonds, 1 residue, 1 model selected
> select #1/A:448-680
1848 atoms, 1891 bonds, 233 residues, 1 model selected
> color sel blue
> select clear
No map chosen to save
No map chosen to save
> save
> /Users/aks3233/Desktop/Str_modeling/UBL_YFP_35K_T7pep_35K_BFP_80796.result/35k.jpg
> width 989 height 678 supersample 3
> set bgColor white
> lighting simple
> lighting simple
> lighting soft
> lighting full
> lighting soft
> lighting full
> lighting simple
> lighting flat
> lighting flat
> lighting full
> lighting shadows false
> lighting shadows true
> lighting shadows false
> lighting flat
> lighting flat
> lighting flat
> lighting full
> lighting soft
> lighting simple
> lighting shadows true
> lighting simple
> view
> view
> view orient
> ui tool show "Side View"
> lighting simple
> lighting simple
> set bgColor black
> set bgColor white
> lighting soft
> lighting soft
> lighting full
> lighting flat
> lighting flat
> lighting flat
> lighting shadows true intensity 0.5
> graphics silhouettes false
> graphics silhouettes true
> graphics silhouettes false
> lighting shadows false
> lighting soft
> lighting simple
> save
> /Users/aks3233/Desktop/Str_modeling/UBL_YFP_35K_T7pep_35K_BFP_80796.result/35k1.jpg
> width 989 height 678 supersample 3
> save
> /Users/aks3233/Desktop/Str_modeling/UBL_YFP_35K_T7pep_35K_BFP_80796.result/35k2.jpg
> width 989 height 678 supersample 3
> save
> /Users/aks3233/Desktop/Str_modeling/UBL_YFP_35K_T7pep_35K_BFP_80796.result/35k3.jpg
> width 989 height 678 supersample 3
> show #2 models
> hide #1 models
> show #3 models
> hide #3 models
> select #2
4760 atoms, 4858 bonds, 609 residues, 1 model selected
> show #2 target m
> select #1/A:448
8 atoms, 7 bonds, 1 residue, 1 model selected
> select #1/A:448-680
1848 atoms, 1891 bonds, 233 residues, 1 model selected
> select #2
4760 atoms, 4858 bonds, 609 residues, 1 model selected
> select #1/A:448
8 atoms, 7 bonds, 1 residue, 1 model selected
> select #1/A:448-680
1848 atoms, 1891 bonds, 233 residues, 1 model selected
> select #2
4760 atoms, 4858 bonds, 609 residues, 1 model selected
> ~select #2
Nothing selected
> show #2 target m
> select #2
4760 atoms, 4858 bonds, 609 residues, 1 model selected
> select #1/A:1-2
15 atoms, 14 bonds, 2 residues, 1 model selected
> select #1/A:1-236
1830 atoms, 1862 bonds, 236 residues, 1 model selected
> select #1
5311 atoms, 5417 bonds, 680 residues, 1 model selected
> ~select #1
Nothing selected
> select #1/A:1-2
15 atoms, 14 bonds, 2 residues, 1 model selected
> select #1/A:1-121
906 atoms, 915 bonds, 121 residues, 1 model selected
> select #1
5311 atoms, 5417 bonds, 680 residues, 1 model selected
> ~select #1
Nothing selected
> hide #2 models
> show #2 models
> view #1 clip false
> select #2
4760 atoms, 4858 bonds, 609 residues, 1 model selected
> select #1/A:1
8 atoms, 7 bonds, 1 residue, 1 model selected
> select #1/A:1-90
674 atoms, 679 bonds, 90 residues, 1 model selected
> select #1/A:1-3
21 atoms, 20 bonds, 3 residues, 1 model selected
> select #1/A:1-131
979 atoms, 988 bonds, 131 residues, 1 model selected
> select #1
5311 atoms, 5417 bonds, 680 residues, 1 model selected
> ~select #1
Nothing selected
> select #1
5311 atoms, 5417 bonds, 680 residues, 1 model selected
> ~select #1
Nothing selected
> show #2 target m
> select #2
4760 atoms, 4858 bonds, 609 residues, 1 model selected
> select clear
> select #1/A:1-2
15 atoms, 14 bonds, 2 residues, 1 model selected
> select #1/A:1-86
648 atoms, 653 bonds, 86 residues, 1 model selected
> select #2
4760 atoms, 4858 bonds, 609 residues, 1 model selected
> select #1/A:260-261
8 atoms, 7 bonds, 2 residues, 1 model selected
> select #1/A:260-409
1155 atoms, 1177 bonds, 150 residues, 1 model selected
> select #1
5311 atoms, 5417 bonds, 680 residues, 1 model selected
> ~select #1
Nothing selected
> select #2
4760 atoms, 4858 bonds, 609 residues, 1 model selected
> show #2 target m
> show #2 target m
> select #2/A:1-609
4760 atoms, 4858 bonds, 609 residues, 1 model selected
> select #2/A:1-609
4760 atoms, 4858 bonds, 609 residues, 1 model selected
> select #1/A:1-3
21 atoms, 20 bonds, 3 residues, 1 model selected
> select #1/A:1-17
141 atoms, 143 bonds, 17 residues, 1 model selected
> select #2/A:1-609
4760 atoms, 4858 bonds, 609 residues, 1 model selected
> sequence chain #2/A
Alignment identifier is 2/A
> select #2/A:1-2
15 atoms, 14 bonds, 2 residues, 1 model selected
> select #2/A:1-4
29 atoms, 28 bonds, 4 residues, 1 model selected
> select #2/A:1
8 atoms, 7 bonds, 1 residue, 1 model selected
> select #2/A:1-76
593 atoms, 598 bonds, 76 residues, 1 model selected
> color sel red
> select #2/A:86
8 atoms, 7 bonds, 1 residue, 1 model selected
> select #2/A:86-250
1299 atoms, 1326 bonds, 165 residues, 1 model selected
> select #2/A:86
8 atoms, 7 bonds, 1 residue, 1 model selected
> select #2/A:86-324
1891 atoms, 1933 bonds, 239 residues, 1 model selected
> color sel forest green
> select #2/A:377
8 atoms, 7 bonds, 1 residue, 1 model selected
> select #2/A:377-609
1848 atoms, 1891 bonds, 233 residues, 1 model selected
> color sel blue
> select clear
Window position QRect(1814,243 655x459) outside any known screen, using
primary screen
> save /Users/aks3233/Desktop/Str_modeling/M0.jpg width 916 height 678
> supersample 3
Window position QRect(1814,243 655x459) outside any known screen, using
primary screen
> save /Users/aks3233/Desktop/Str_modeling/M01.jpg width 916 height 678
> supersample 3
> show #3 models
> hide #2 models
> show #3 target m
> select #3/A:1-680
5279 atoms, 5385 bonds, 680 residues, 1 model selected
> select #2/A:1
8 atoms, 7 bonds, 1 residue, 1 model selected
> select #2/A:1-137
1019 atoms, 1028 bonds, 137 residues, 1 model selected
> select #3
5279 atoms, 5385 bonds, 680 residues, 1 model selected
> select clear
> select #2/A:569-570
24 atoms, 25 bonds, 2 residues, 1 model selected
> select #2/A:569-609
347 atoms, 354 bonds, 41 residues, 1 model selected
> select #3
5279 atoms, 5385 bonds, 680 residues, 1 model selected
> show #3 target m
> select #2/A:481-483
24 atoms, 23 bonds, 3 residues, 1 model selected
> select #2/A:481-483
24 atoms, 23 bonds, 3 residues, 1 model selected
> select #2/A:486
8 atoms, 7 bonds, 1 residue, 1 model selected
> select #2/A:486-609
982 atoms, 1001 bonds, 124 residues, 1 model selected
> select #3
5279 atoms, 5385 bonds, 680 residues, 1 model selected
> select #2/A:1
8 atoms, 7 bonds, 1 residue, 1 model selected
> select #2/A:1-371
2882 atoms, 2936 bonds, 371 residues, 1 model selected
> sequence chain #3/A
Alignment identifier is 3/A
Traceback (most recent call last):
File
"/Users/aks3233/Desktop/ChimeraX-1.2.5.app/Contents/Library/Frameworks/Python.framework/Versions/3.8/lib/python3.8/site-
packages/chimerax/ui/gui.py", line 2149, in <lambda>
dw.closeEvent = lambda e, *, tw=tool_window, mw=mw: mw.close_request(tw, e)
File
"/Users/aks3233/Desktop/ChimeraX-1.2.5.app/Contents/Library/Frameworks/Python.framework/Versions/3.8/lib/python3.8/site-
packages/chimerax/ui/gui.py", line 626, in close_request
tool_instance.delete()
File
"/Users/aks3233/Desktop/ChimeraX-1.2.5.app/Contents/Library/Frameworks/Python.framework/Versions/3.8/lib/python3.8/site-
packages/chimerax/seq-view/tool.py", line 512, in delete
ToolInstance.delete(self)
File
"/Users/aks3233/Desktop/ChimeraX-1.2.5.app/Contents/Library/Frameworks/Python.framework/Versions/3.8/lib/python3.8/site-
packages/chimerax/core/tools.py", line 154, in delete
self.session.ui.remove_tool(self)
File
"/Users/aks3233/Desktop/ChimeraX-1.2.5.app/Contents/Library/Frameworks/Python.framework/Versions/3.8/lib/python3.8/site-
packages/chimerax/ui/gui.py", line 345, in remove_tool
self.main_window.remove_tool(tool_instance)
File
"/Users/aks3233/Desktop/ChimeraX-1.2.5.app/Contents/Library/Frameworks/Python.framework/Versions/3.8/lib/python3.8/site-
packages/chimerax/ui/gui.py", line 725, in remove_tool
tw._destroy()
File
"/Users/aks3233/Desktop/ChimeraX-1.2.5.app/Contents/Library/Frameworks/Python.framework/Versions/3.8/lib/python3.8/site-
packages/chimerax/ui/gui.py", line 2049, in _destroy
self.__toolkit.destroy()
File
"/Users/aks3233/Desktop/ChimeraX-1.2.5.app/Contents/Library/Frameworks/Python.framework/Versions/3.8/lib/python3.8/site-
packages/chimerax/ui/gui.py", line 2189, in destroy
sbar.destroy()
File
"/Users/aks3233/Desktop/ChimeraX-1.2.5.app/Contents/Library/Frameworks/Python.framework/Versions/3.8/lib/python3.8/site-
packages/chimerax/ui/statusbar.py", line 51, in destroy
v.delete()
File
"/Users/aks3233/Desktop/ChimeraX-1.2.5.app/Contents/Library/Frameworks/Python.framework/Versions/3.8/lib/python3.8/site-
packages/chimerax/graphics/opengl.py", line 438, in delete
self.make_current()
File
"/Users/aks3233/Desktop/ChimeraX-1.2.5.app/Contents/Library/Frameworks/Python.framework/Versions/3.8/lib/python3.8/site-
packages/chimerax/graphics/opengl.py", line 478, in make_current
return self._opengl_context.make_current()
File
"/Users/aks3233/Desktop/ChimeraX-1.2.5.app/Contents/Library/Frameworks/Python.framework/Versions/3.8/lib/python3.8/site-
packages/chimerax/graphics/opengl.py", line 99, in make_current
qc = self._initialize_context()
File
"/Users/aks3233/Desktop/ChimeraX-1.2.5.app/Contents/Library/Frameworks/Python.framework/Versions/3.8/lib/python3.8/site-
packages/chimerax/graphics/opengl.py", line 125, in _initialize_context
qc.setScreen(self._screen)
RuntimeError: wrapped C/C++ object of type QScreen has been deleted
RuntimeError: wrapped C/C++ object of type QScreen has been deleted
File
"/Users/aks3233/Desktop/ChimeraX-1.2.5.app/Contents/Library/Frameworks/Python.framework/Versions/3.8/lib/python3.8/site-
packages/chimerax/graphics/opengl.py", line 125, in _initialize_context
qc.setScreen(self._screen)
See log for complete Python traceback.
Window position QRect(2144,458 100x30) outside any known screen, using primary
screen
OpenGL version: 4.1 INTEL-14.7.18
OpenGL renderer: Intel Iris Pro OpenGL Engine
OpenGL vendor: Intel Inc.Hardware:
Hardware Overview:
Model Name: MacBook Pro
Model Identifier: MacBookPro11,2
Processor Name: Quad-Core Intel Core i7
Processor Speed: 2 GHz
Number of Processors: 1
Total Number of Cores: 4
L2 Cache (per Core): 256 KB
L3 Cache: 6 MB
Hyper-Threading Technology: Enabled
Memory: 8 GB
Boot ROM Version: 431.140.6.0.0
SMC Version (system): 2.18f15
Software:
System Software Overview:
System Version: macOS 10.15.7 (19H1323)
Kernel Version: Darwin 19.6.0
Time since boot: 21 days 7:48
Graphics/Displays:
Intel Iris Pro:
Chipset Model: Intel Iris Pro
Type: GPU
Bus: Built-In
VRAM (Dynamic, Max): 1536 MB
Vendor: Intel
Device ID: 0x0d26
Revision ID: 0x0008
Metal: Supported, feature set macOS GPUFamily1 v4
Displays:
Color LCD:
Display Type: Built-In Retina LCD
Resolution: 2880 x 1800 Retina
Framebuffer Depth: 24-Bit Color (ARGB8888)
Main Display: Yes
Mirror: Off
Online: Yes
Automatically Adjust Brightness: No
Connection Type: Internal
DELL ST2320L:
Resolution: 1920 x 1080 (1080p FHD - Full High Definition)
UI Looks like: 1920 x 1080 @ 60 Hz
Framebuffer Depth: 24-Bit Color (ARGB8888)
Display Serial Number: DFF580C71NFL
Mirror: Off
Online: Yes
Rotation: Supported
Automatically Adjust Brightness: No
Locale: (None, 'UTF-8')
PyQt5 5.15.2, Qt 5.15.2
Installed Packages:
alabaster: 0.7.12
appdirs: 1.4.4
appnope: 0.1.2
Babel: 2.9.1
backcall: 0.2.0
blockdiag: 2.0.1
certifi: 2020.12.5
cftime: 1.5.0
chardet: 3.0.4
ChimeraX-AddCharge: 1.0.1
ChimeraX-AddH: 2.1.6
ChimeraX-AlignmentAlgorithms: 2.0
ChimeraX-AlignmentHdrs: 3.2
ChimeraX-AlignmentMatrices: 2.0
ChimeraX-Alignments: 2.1
ChimeraX-AmberInfo: 1.0
ChimeraX-Arrays: 1.0
ChimeraX-Atomic: 1.13.2
ChimeraX-AtomicLibrary: 3.1.3
ChimeraX-AtomSearch: 2.0
ChimeraX-AtomSearchLibrary: 1.0
ChimeraX-AxesPlanes: 2.0
ChimeraX-BasicActions: 1.1
ChimeraX-BILD: 1.0
ChimeraX-BlastProtein: 1.1
ChimeraX-BondRot: 2.0
ChimeraX-BugReporter: 1.0
ChimeraX-BuildStructure: 2.5.2
ChimeraX-Bumps: 1.0
ChimeraX-BundleBuilder: 1.1
ChimeraX-ButtonPanel: 1.0
ChimeraX-CageBuilder: 1.0
ChimeraX-CellPack: 1.0
ChimeraX-Centroids: 1.1
ChimeraX-ChemGroup: 2.0
ChimeraX-Clashes: 2.1
ChimeraX-ColorActions: 1.0
ChimeraX-ColorGlobe: 1.0
ChimeraX-ColorKey: 1.2.1
ChimeraX-CommandLine: 1.1.4
ChimeraX-ConnectStructure: 2.0
ChimeraX-Contacts: 1.0
ChimeraX-Core: 1.2.5
ChimeraX-CoreFormats: 1.0
ChimeraX-coulombic: 1.1.1
ChimeraX-Crosslinks: 1.0
ChimeraX-Crystal: 1.0
ChimeraX-CrystalContacts: 1.0
ChimeraX-DataFormats: 1.1
ChimeraX-Dicom: 1.0
ChimeraX-DistMonitor: 1.1.3
ChimeraX-DistUI: 1.0
ChimeraX-Dssp: 2.0
ChimeraX-EMDB-SFF: 1.0
ChimeraX-ExperimentalCommands: 1.0
ChimeraX-FileHistory: 1.0
ChimeraX-FunctionKey: 1.0
ChimeraX-Geometry: 1.1
ChimeraX-gltf: 1.0
ChimeraX-Graphics: 1.0
ChimeraX-Hbonds: 2.1
ChimeraX-Help: 1.1
ChimeraX-HKCage: 1.3
ChimeraX-IHM: 1.0
ChimeraX-ImageFormats: 1.1
ChimeraX-IMOD: 1.0
ChimeraX-IO: 1.0.1
ChimeraX-Label: 1.0
ChimeraX-ListInfo: 1.1.1
ChimeraX-Log: 1.1.2
ChimeraX-LookingGlass: 1.1
ChimeraX-Maestro: 1.8.1
ChimeraX-Map: 1.0.2
ChimeraX-MapData: 2.0
ChimeraX-MapEraser: 1.0
ChimeraX-MapFilter: 2.0
ChimeraX-MapFit: 2.0
ChimeraX-MapSeries: 2.0
ChimeraX-Markers: 1.0
ChimeraX-Mask: 1.0
ChimeraX-MatchMaker: 1.2.1
ChimeraX-MDcrds: 2.2
ChimeraX-MedicalToolbar: 1.0.1
ChimeraX-Meeting: 1.0
ChimeraX-MLP: 1.1
ChimeraX-mmCIF: 2.3
ChimeraX-MMTF: 2.1
ChimeraX-Modeller: 1.0.1
ChimeraX-ModelPanel: 1.0.1
ChimeraX-ModelSeries: 1.0
ChimeraX-Mol2: 2.0
ChimeraX-Morph: 1.0
ChimeraX-MouseModes: 1.1
ChimeraX-Movie: 1.0
ChimeraX-Neuron: 1.0
ChimeraX-Nucleotides: 2.0.1
ChimeraX-OpenCommand: 1.5
ChimeraX-PDB: 2.4.1
ChimeraX-PDBBio: 1.0
ChimeraX-PDBLibrary: 1.0.1
ChimeraX-PDBMatrices: 1.0
ChimeraX-PickBlobs: 1.0
ChimeraX-Positions: 1.0
ChimeraX-PresetMgr: 1.0.1
ChimeraX-PubChem: 2.0.1
ChimeraX-ReadPbonds: 1.0
ChimeraX-Registration: 1.1
ChimeraX-RemoteControl: 1.0
ChimeraX-ResidueFit: 1.0
ChimeraX-RestServer: 1.1
ChimeraX-RNALayout: 1.0
ChimeraX-RotamerLibMgr: 2.0
ChimeraX-RotamerLibsDunbrack: 2.0
ChimeraX-RotamerLibsDynameomics: 2.0
ChimeraX-RotamerLibsRichardson: 2.0
ChimeraX-SaveCommand: 1.4
ChimeraX-SchemeMgr: 1.0
ChimeraX-SDF: 2.0
ChimeraX-Segger: 1.0
ChimeraX-Segment: 1.0
ChimeraX-SeqView: 2.3
ChimeraX-Shape: 1.0.1
ChimeraX-Shell: 1.0
ChimeraX-Shortcuts: 1.0
ChimeraX-ShowAttr: 1.0
ChimeraX-ShowSequences: 1.0
ChimeraX-SideView: 1.0
ChimeraX-Smiles: 2.0.1
ChimeraX-SmoothLines: 1.0
ChimeraX-SpaceNavigator: 1.0
ChimeraX-StdCommands: 1.3.1
ChimeraX-STL: 1.0
ChimeraX-Storm: 1.0
ChimeraX-Struts: 1.0
ChimeraX-Surface: 1.0
ChimeraX-SwapAA: 2.0
ChimeraX-SwapRes: 2.1
ChimeraX-TapeMeasure: 1.0
ChimeraX-Test: 1.0
ChimeraX-Toolbar: 1.0.1
ChimeraX-ToolshedUtils: 1.2
ChimeraX-Tug: 1.0
ChimeraX-UI: 1.7.6
ChimeraX-uniprot: 2.1
ChimeraX-UnitCell: 1.0
ChimeraX-ViewDockX: 1.0
ChimeraX-Vive: 1.1
ChimeraX-VolumeMenu: 1.0
ChimeraX-VTK: 1.0
ChimeraX-WavefrontOBJ: 1.0
ChimeraX-WebCam: 1.0
ChimeraX-WebServices: 1.0
ChimeraX-Zone: 1.0
colorama: 0.4.3
comtypes: 1.1.7
cxservices: 1.0
cycler: 0.10.0
Cython: 0.29.21
decorator: 5.0.9
distlib: 0.3.1
docutils: 0.16
filelock: 3.0.12
funcparserlib: 0.3.6
grako: 3.16.5
h5py: 2.10.0
html2text: 2020.1.16
idna: 2.10
ihm: 0.17
imagecodecs: 2020.5.30
imagesize: 1.2.0
ipykernel: 5.3.4
ipython: 7.18.1
ipython-genutils: 0.2.0
jedi: 0.17.2
Jinja2: 2.11.2
jupyter-client: 6.1.7
jupyter-core: 4.7.1
kiwisolver: 1.3.1
line-profiler: 2.1.2
lxml: 4.6.2
lz4: 3.1.0
MarkupSafe: 2.0.1
matplotlib: 3.3.2
matplotlib-inline: 0.1.2
msgpack: 1.0.0
netCDF4: 1.5.4
networkx: 2.5
numexpr: 2.7.3
numpy: 1.19.2
numpydoc: 1.1.0
openvr: 1.14.1501
packaging: 20.9
ParmEd: 3.2.0
parso: 0.7.1
pexpect: 4.8.0
pickleshare: 0.7.5
Pillow: 7.2.0
pip: 21.0.1
pkginfo: 1.5.0.1
prompt-toolkit: 3.0.18
psutil: 5.7.2
ptyprocess: 0.7.0
pycollada: 0.7.1
pydicom: 2.0.0
Pygments: 2.7.1
PyOpenGL: 3.1.5
PyOpenGL-accelerate: 3.1.5
pyparsing: 2.4.7
PyQt5-commercial: 5.15.2
PyQt5-sip: 12.8.1
PyQtWebEngine-commercial: 5.15.2
python-dateutil: 2.8.1
pytz: 2021.1
pyzmq: 22.0.3
qtconsole: 4.7.7
QtPy: 1.9.0
RandomWords: 0.3.0
requests: 2.24.0
scipy: 1.5.2
setuptools: 50.3.2
sfftk-rw: 0.6.7.dev1
six: 1.15.0
snowballstemmer: 2.1.0
sortedcontainers: 2.2.2
Sphinx: 3.2.1
sphinxcontrib-applehelp: 1.0.2
sphinxcontrib-blockdiag: 2.0.0
sphinxcontrib-devhelp: 1.0.2
sphinxcontrib-htmlhelp: 2.0.0
sphinxcontrib-jsmath: 1.0.1
sphinxcontrib-qthelp: 1.0.3
sphinxcontrib-serializinghtml: 1.1.5
suds-jurko: 0.6
tables: 3.6.1
tifffile: 2020.9.3
tinyarray: 1.2.3
tornado: 6.1
traitlets: 5.0.5
urllib3: 1.25.11
wcwidth: 0.2.5
webcolors: 1.11.1
wheel: 0.36.0
wheel-filename: 1.3.0
Change History (2)
comment:1 by , 5 years ago
| Component: | Unassigned → Window Toolkit |
|---|---|
| Owner: | set to |
| Platform: | → all |
| Project: | → ChimeraX |
| Status: | new → assigned |
| Summary: | ChimeraX bug report submission → Dual display problem |
comment:2 by , 5 years ago
| Resolution: | → duplicate |
|---|---|
| Status: | assigned → closed |
Note:
See TracTickets
for help on using tickets.