Opened 5 years ago

Closed 5 years ago

#5873 closed defect (duplicate)

Dual display problem

Reported by: chimerax-bug-report@… Owned by: Tom Goddard
Priority: normal Milestone:
Component: Window Toolkit Version:
Keywords: Cc:
Blocked By: Blocking:
Notify when closed: Platform: all
Project: ChimeraX

Description

The following bug report has been submitted:
Platform:        macOS-10.15.7-x86_64-i386-64bit
ChimeraX Version: 1.2.5 (2021-05-24 04:13:57 UTC)
Description
(Describe the actions that caused this problem to occur here)

Log:
UCSF ChimeraX version: 1.2.5 (2021-05-24)  
© 2016-2021 Regents of the University of California. All rights reserved.  

> open "/Users/aks3233/Desktop/Str_modeling/35K linker.cxs" format session

Log from Wed Dec 22 14:55:57 2021UCSF ChimeraX version: 1.2.5 (2021-05-24)  
© 2016-2021 Regents of the University of California. All rights reserved.  
How to cite UCSF ChimeraX  

> open
> /Users/aks3233/Box/MMTV/SP_59_61_b24d1.result/MMTVSPMutant5961_b24d1_unrelaxed_model_1.pdb
> format pdb

Chain information for MMTVSPMutant5961_b24d1_unrelaxed_model_1.pdb #1  
---  
Chain | Description  
A | No description available  
  

> open
> /Users/aks3233/Desktop/Str_modeling/UBL_YFP_35K_T7pep_35K_BFP_80796.result/UBL_YFP_35K_T7pep_35K_BFP_80796_unrelaxed_rank_1_model_4.pdb

Chain information for
UBL_YFP_35K_T7pep_35K_BFP_80796_unrelaxed_rank_1_model_4.pdb #2  
---  
Chain | Description  
A | No description available  
  

> sequence chain #1/A

Alignment identifier is 1/A  

> hide #1 models

> hide #1 target m

> hide #1 target m

> close #1

> sequence chain #2/A

Alignment identifier is 2/A  

> open
> /Users/aks3233/Desktop/Str_modeling/2A_9d63a.result/2A_9d63a_unrelaxed_rank_5_model_1.pdb

Chain information for 2A_9d63a_unrelaxed_rank_5_model_1.pdb #1  
---  
Chain | Description  
A | No description available  
  

> hide #1 models

> open
> /Users/aks3233/Desktop/Str_modeling/m2_29515.result/m2_29515_unrelaxed_rank_4_model_1.pdb

Chain information for m2_29515_unrelaxed_rank_4_model_1.pdb #3  
---  
Chain | Description  
A | No description available  
  

> hide #3 models

> open
> /Users/aks3233/Desktop/Str_modeling/m2_70726.result/m2_70726_unrelaxed_rank_1_model_5.pdb

Chain information for m2_70726_unrelaxed_rank_1_model_5.pdb #4  
---  
Chain | Description  
A | No description available  
  

> hide #4 models

> open
> /Users/aks3233/Desktop/Str_modeling/UBL_YFP_M0_T7pep_M0_BFP_198ce.result/UBL_YFP_M0_T7pep_M0_BFP_198ce_unrelaxed_rank_1_model_3.pdb

Chain information for
UBL_YFP_M0_T7pep_M0_BFP_198ce_unrelaxed_rank_1_model_3.pdb #5  
---  
Chain | Description  
A | No description available  
  

> hide #5 models

> hide #2 models

> show #2 models

> show #2 target m

> select #2

5311 atoms, 5417 bonds, 680 residues, 1 model selected  

> ~select #2

Nothing selected  

> select #3

4918 atoms, 5018 bonds, 639 residues, 1 model selected  

> ~select #3

Nothing selected  

> select #2/A:76

9 atoms, 8 bonds, 1 residue, 1 model selected  

> select #2/A:1-76

593 atoms, 598 bonds, 76 residues, 1 model selected  

> color sel orange

> select clear

> select #2/A:86-87

15 atoms, 14 bonds, 2 residues, 1 model selected  

> select #2/A:86-92

52 atoms, 51 bonds, 7 residues, 1 model selected  

> select #2/A:86-89

30 atoms, 29 bonds, 4 residues, 1 model selected  

> select #2/A:86-242

1239 atoms, 1266 bonds, 157 residues, 1 model selected  

> select #2/A:243-244

18 atoms, 17 bonds, 2 residues, 1 model selected  

> select #2/A:243-248

47 atoms, 46 bonds, 6 residues, 1 model selected  

> select #2/A:86

8 atoms, 7 bonds, 1 residue, 1 model selected  

> select #2/A:86-229

1132 atoms, 1156 bonds, 144 residues, 1 model selected  

> select #2/A:316-317

17 atoms, 17 bonds, 2 residues, 1 model selected  

> select #2/A:310-317

53 atoms, 53 bonds, 8 residues, 1 model selected  

> select
> #2/A:2-7,13-18,42-45,67-72,97-108,111-122,127-134,178-186,191-201,204-214,234-241,246-256,262-273,285-294,303-313,456-466,469-480,485-494,535-543,548-558,561-571,590-597,600-610,616-627,640-652,657-667

2089 atoms, 2105 bonds, 256 residues, 1 model selected  

> select clear

> select #2/A:323-324

21 atoms, 21 bonds, 2 residues, 1 model selected  

> select #2/A:312-324

97 atoms, 98 bonds, 13 residues, 1 model selected  

> select
> #2/A:2-7,13-18,42-45,67-72,97-108,111-122,127-134,178-186,191-201,204-214,234-241,246-256,262-273,285-294,303-313,456-466,469-480,485-494,535-543,548-558,561-571,590-597,600-610,616-627,640-652,657-667

2089 atoms, 2105 bonds, 256 residues, 1 model selected  

> select clear

> select #2/A:300

9 atoms, 8 bonds, 1 residue, 1 model selected  

> select #2/A:296-300

41 atoms, 41 bonds, 5 residues, 1 model selected  

> select #2/A:324

9 atoms, 8 bonds, 1 residue, 1 model selected  

> select #2/A:86-324

1891 atoms, 1933 bonds, 239 residues, 1 model selected  

> color sel forest green

> select #2/A:448

8 atoms, 7 bonds, 1 residue, 1 model selected  

> select #2/A:448-680

1848 atoms, 1891 bonds, 233 residues, 1 model selected  

> color sel blue

> select clear

> save "/Users/aks3233/Desktop/Str_modeling/35K linker.cxs"

——— End of log from Wed Dec 22 14:55:57 2021 ———

opened ChimeraX session  

> close

> open
> /Users/aks3233/Desktop/Str_modeling/UBL_YFP_35K_T7pep_35K_BFP_80796.result/UBL_YFP_35K_T7pep_35K_BFP_80796_unrelaxed_rank_1_model_4.pdb

Chain information for
UBL_YFP_35K_T7pep_35K_BFP_80796_unrelaxed_rank_1_model_4.pdb #1  
---  
Chain | Description  
A | No description available  
  

> select /A:1-680

5311 atoms, 5417 bonds, 680 residues, 1 model selected  

> show target m

> sequence chain #1/A

Alignment identifier is 1/A  

> open
> /Users/aks3233/Desktop/Str_modeling/UBL_YFP_M0_T7pep_M0_BFP_198ce.result/UBL_YFP_M0_T7pep_M0_BFP_198ce_unrelaxed_rank_1_model_3.pdb

Chain information for
UBL_YFP_M0_T7pep_M0_BFP_198ce_unrelaxed_rank_1_model_3.pdb #2  
---  
Chain | Description  
A | No description available  
  

> open
> /Users/aks3233/Desktop/Str_modeling/2A_9d63a.result/2A_9d63a_unrelaxed_rank_1_model_5.pdb

Chain information for 2A_9d63a_unrelaxed_rank_1_model_5.pdb #3  
---  
Chain | Description  
A | No description available  
  

> open
> /Users/aks3233/Desktop/Str_modeling/m2_29515.result/m2_29515_unrelaxed_rank_4_model_1.pdb

Chain information for m2_29515_unrelaxed_rank_4_model_1.pdb #4  
---  
Chain | Description  
A | No description available  
  

> open
> /Users/aks3233/Desktop/Str_modeling/m2_70726.result/m2_70726_unrelaxed_rank_4_model_1.pdb

Chain information for m2_70726_unrelaxed_rank_4_model_1.pdb #5  
---  
Chain | Description  
A | No description available  
  

> hide #5 models

> hide #4 models

> hide #3 models

> hide #2 models

> ~select #1

Nothing selected  

> MVSLTFKNFKKEKVPLDLEPSNTILETKTKLAQSISCEESQIKLIYSGKVLQDSKTVSECGLKDGDQVVFMVSQKK

Unknown command:
MVSLTFKNFKKEKVPLDLEPSNTILETKTKLAQSISCEESQIKLIYSGKVLQDSKTVSECGLKDGDQVVFMVSQKK  

> select
> #1/A:2-7,13-18,42-45,67-72,97-108,111-122,127-134,178-186,191-201,204-214,234-241,246-256,262-273,285-294,303-313,456-466,469-480,485-494,535-543,548-558,561-571,590-597,600-610,616-627,640-652,657-667

2089 atoms, 2105 bonds, 256 residues, 1 model selected  

> select #1/A:141-151

83 atoms, 86 bonds, 11 residues, 1 model selected  

> select #1/A:106-141

259 atoms, 261 bonds, 36 residues, 1 model selected  

> select #1/A:1

8 atoms, 7 bonds, 1 residue, 1 model selected  

> select #1/A:1-76

593 atoms, 598 bonds, 76 residues, 1 model selected  

> color sel red

> select #1/A:86-87

15 atoms, 14 bonds, 2 residues, 1 model selected  

> select #1/A:86-88

21 atoms, 20 bonds, 3 residues, 1 model selected  

> select #1/A:86-87

15 atoms, 14 bonds, 2 residues, 1 model selected  

> select #1/A:86-344

2044 atoms, 2088 bonds, 259 residues, 1 model selected  

> select #1/A:277

4 atoms, 3 bonds, 1 residue, 1 model selected  

> select #1/A:262-277

123 atoms, 125 bonds, 16 residues, 1 model selected  

> select #1/A:314

4 atoms, 3 bonds, 1 residue, 1 model selected  

> select #1/A:287-314

222 atoms, 225 bonds, 28 residues, 1 model selected  

> select #1/A:324

9 atoms, 8 bonds, 1 residue, 1 model selected  

> select #1/A:86-324

1891 atoms, 1933 bonds, 239 residues, 1 model selected  

> color sel forest green

> select #1/A:448

8 atoms, 7 bonds, 1 residue, 1 model selected  

> select #1/A:448-680

1848 atoms, 1891 bonds, 233 residues, 1 model selected  

> color sel blue

> select clear

No map chosen to save  
No map chosen to save  

> save
> /Users/aks3233/Desktop/Str_modeling/UBL_YFP_35K_T7pep_35K_BFP_80796.result/35k.jpg
> width 989 height 678 supersample 3

> set bgColor white

> lighting simple

> lighting simple

> lighting soft

> lighting full

> lighting soft

> lighting full

> lighting simple

> lighting flat

> lighting flat

> lighting full

> lighting shadows false

> lighting shadows true

> lighting shadows false

> lighting flat

> lighting flat

> lighting flat

> lighting full

> lighting soft

> lighting simple

> lighting shadows true

> lighting simple

> view

> view

> view orient

> ui tool show "Side View"

> lighting simple

> lighting simple

> set bgColor black

> set bgColor white

> lighting soft

> lighting soft

> lighting full

> lighting flat

> lighting flat

> lighting flat

> lighting shadows true intensity 0.5

> graphics silhouettes false

> graphics silhouettes true

> graphics silhouettes false

> lighting shadows false

> lighting soft

> lighting simple

> save
> /Users/aks3233/Desktop/Str_modeling/UBL_YFP_35K_T7pep_35K_BFP_80796.result/35k1.jpg
> width 989 height 678 supersample 3

> save
> /Users/aks3233/Desktop/Str_modeling/UBL_YFP_35K_T7pep_35K_BFP_80796.result/35k2.jpg
> width 989 height 678 supersample 3

> save
> /Users/aks3233/Desktop/Str_modeling/UBL_YFP_35K_T7pep_35K_BFP_80796.result/35k3.jpg
> width 989 height 678 supersample 3

> show #2 models

> hide #1 models

> show #3 models

> hide #3 models

> select #2

4760 atoms, 4858 bonds, 609 residues, 1 model selected  

> show #2 target m

> select #1/A:448

8 atoms, 7 bonds, 1 residue, 1 model selected  

> select #1/A:448-680

1848 atoms, 1891 bonds, 233 residues, 1 model selected  

> select #2

4760 atoms, 4858 bonds, 609 residues, 1 model selected  

> select #1/A:448

8 atoms, 7 bonds, 1 residue, 1 model selected  

> select #1/A:448-680

1848 atoms, 1891 bonds, 233 residues, 1 model selected  

> select #2

4760 atoms, 4858 bonds, 609 residues, 1 model selected  

> ~select #2

Nothing selected  

> show #2 target m

> select #2

4760 atoms, 4858 bonds, 609 residues, 1 model selected  

> select #1/A:1-2

15 atoms, 14 bonds, 2 residues, 1 model selected  

> select #1/A:1-236

1830 atoms, 1862 bonds, 236 residues, 1 model selected  

> select #1

5311 atoms, 5417 bonds, 680 residues, 1 model selected  

> ~select #1

Nothing selected  

> select #1/A:1-2

15 atoms, 14 bonds, 2 residues, 1 model selected  

> select #1/A:1-121

906 atoms, 915 bonds, 121 residues, 1 model selected  

> select #1

5311 atoms, 5417 bonds, 680 residues, 1 model selected  

> ~select #1

Nothing selected  

> hide #2 models

> show #2 models

> view #1 clip false

> select #2

4760 atoms, 4858 bonds, 609 residues, 1 model selected  

> select #1/A:1

8 atoms, 7 bonds, 1 residue, 1 model selected  

> select #1/A:1-90

674 atoms, 679 bonds, 90 residues, 1 model selected  

> select #1/A:1-3

21 atoms, 20 bonds, 3 residues, 1 model selected  

> select #1/A:1-131

979 atoms, 988 bonds, 131 residues, 1 model selected  

> select #1

5311 atoms, 5417 bonds, 680 residues, 1 model selected  

> ~select #1

Nothing selected  

> select #1

5311 atoms, 5417 bonds, 680 residues, 1 model selected  

> ~select #1

Nothing selected  

> show #2 target m

> select #2

4760 atoms, 4858 bonds, 609 residues, 1 model selected  

> select clear

> select #1/A:1-2

15 atoms, 14 bonds, 2 residues, 1 model selected  

> select #1/A:1-86

648 atoms, 653 bonds, 86 residues, 1 model selected  

> select #2

4760 atoms, 4858 bonds, 609 residues, 1 model selected  

> select #1/A:260-261

8 atoms, 7 bonds, 2 residues, 1 model selected  

> select #1/A:260-409

1155 atoms, 1177 bonds, 150 residues, 1 model selected  

> select #1

5311 atoms, 5417 bonds, 680 residues, 1 model selected  

> ~select #1

Nothing selected  

> select #2

4760 atoms, 4858 bonds, 609 residues, 1 model selected  

> show #2 target m

> show #2 target m

> select #2/A:1-609

4760 atoms, 4858 bonds, 609 residues, 1 model selected  

> select #2/A:1-609

4760 atoms, 4858 bonds, 609 residues, 1 model selected  

> select #1/A:1-3

21 atoms, 20 bonds, 3 residues, 1 model selected  

> select #1/A:1-17

141 atoms, 143 bonds, 17 residues, 1 model selected  

> select #2/A:1-609

4760 atoms, 4858 bonds, 609 residues, 1 model selected  

> sequence chain #2/A

Alignment identifier is 2/A  

> select #2/A:1-2

15 atoms, 14 bonds, 2 residues, 1 model selected  

> select #2/A:1-4

29 atoms, 28 bonds, 4 residues, 1 model selected  

> select #2/A:1

8 atoms, 7 bonds, 1 residue, 1 model selected  

> select #2/A:1-76

593 atoms, 598 bonds, 76 residues, 1 model selected  

> color sel red

> select #2/A:86

8 atoms, 7 bonds, 1 residue, 1 model selected  

> select #2/A:86-250

1299 atoms, 1326 bonds, 165 residues, 1 model selected  

> select #2/A:86

8 atoms, 7 bonds, 1 residue, 1 model selected  

> select #2/A:86-324

1891 atoms, 1933 bonds, 239 residues, 1 model selected  

> color sel forest green

> select #2/A:377

8 atoms, 7 bonds, 1 residue, 1 model selected  

> select #2/A:377-609

1848 atoms, 1891 bonds, 233 residues, 1 model selected  

> color sel blue

> select clear

Window position QRect(1814,243 655x459) outside any known screen, using
primary screen  

> save /Users/aks3233/Desktop/Str_modeling/M0.jpg width 916 height 678
> supersample 3

Window position QRect(1814,243 655x459) outside any known screen, using
primary screen  

> save /Users/aks3233/Desktop/Str_modeling/M01.jpg width 916 height 678
> supersample 3

> show #3 models

> hide #2 models

> show #3 target m

> select #3/A:1-680

5279 atoms, 5385 bonds, 680 residues, 1 model selected  

> select #2/A:1

8 atoms, 7 bonds, 1 residue, 1 model selected  

> select #2/A:1-137

1019 atoms, 1028 bonds, 137 residues, 1 model selected  

> select #3

5279 atoms, 5385 bonds, 680 residues, 1 model selected  

> select clear

> select #2/A:569-570

24 atoms, 25 bonds, 2 residues, 1 model selected  

> select #2/A:569-609

347 atoms, 354 bonds, 41 residues, 1 model selected  

> select #3

5279 atoms, 5385 bonds, 680 residues, 1 model selected  

> show #3 target m

> select #2/A:481-483

24 atoms, 23 bonds, 3 residues, 1 model selected  

> select #2/A:481-483

24 atoms, 23 bonds, 3 residues, 1 model selected  

> select #2/A:486

8 atoms, 7 bonds, 1 residue, 1 model selected  

> select #2/A:486-609

982 atoms, 1001 bonds, 124 residues, 1 model selected  

> select #3

5279 atoms, 5385 bonds, 680 residues, 1 model selected  

> select #2/A:1

8 atoms, 7 bonds, 1 residue, 1 model selected  

> select #2/A:1-371

2882 atoms, 2936 bonds, 371 residues, 1 model selected  

> sequence chain #3/A

Alignment identifier is 3/A  
Traceback (most recent call last):  
File
"/Users/aks3233/Desktop/ChimeraX-1.2.5.app/Contents/Library/Frameworks/Python.framework/Versions/3.8/lib/python3.8/site-
packages/chimerax/ui/gui.py", line 2149, in <lambda>  
dw.closeEvent = lambda e, *, tw=tool_window, mw=mw: mw.close_request(tw, e)  
File
"/Users/aks3233/Desktop/ChimeraX-1.2.5.app/Contents/Library/Frameworks/Python.framework/Versions/3.8/lib/python3.8/site-
packages/chimerax/ui/gui.py", line 626, in close_request  
tool_instance.delete()  
File
"/Users/aks3233/Desktop/ChimeraX-1.2.5.app/Contents/Library/Frameworks/Python.framework/Versions/3.8/lib/python3.8/site-
packages/chimerax/seq-view/tool.py", line 512, in delete  
ToolInstance.delete(self)  
File
"/Users/aks3233/Desktop/ChimeraX-1.2.5.app/Contents/Library/Frameworks/Python.framework/Versions/3.8/lib/python3.8/site-
packages/chimerax/core/tools.py", line 154, in delete  
self.session.ui.remove_tool(self)  
File
"/Users/aks3233/Desktop/ChimeraX-1.2.5.app/Contents/Library/Frameworks/Python.framework/Versions/3.8/lib/python3.8/site-
packages/chimerax/ui/gui.py", line 345, in remove_tool  
self.main_window.remove_tool(tool_instance)  
File
"/Users/aks3233/Desktop/ChimeraX-1.2.5.app/Contents/Library/Frameworks/Python.framework/Versions/3.8/lib/python3.8/site-
packages/chimerax/ui/gui.py", line 725, in remove_tool  
tw._destroy()  
File
"/Users/aks3233/Desktop/ChimeraX-1.2.5.app/Contents/Library/Frameworks/Python.framework/Versions/3.8/lib/python3.8/site-
packages/chimerax/ui/gui.py", line 2049, in _destroy  
self.__toolkit.destroy()  
File
"/Users/aks3233/Desktop/ChimeraX-1.2.5.app/Contents/Library/Frameworks/Python.framework/Versions/3.8/lib/python3.8/site-
packages/chimerax/ui/gui.py", line 2189, in destroy  
sbar.destroy()  
File
"/Users/aks3233/Desktop/ChimeraX-1.2.5.app/Contents/Library/Frameworks/Python.framework/Versions/3.8/lib/python3.8/site-
packages/chimerax/ui/statusbar.py", line 51, in destroy  
v.delete()  
File
"/Users/aks3233/Desktop/ChimeraX-1.2.5.app/Contents/Library/Frameworks/Python.framework/Versions/3.8/lib/python3.8/site-
packages/chimerax/graphics/opengl.py", line 438, in delete  
self.make_current()  
File
"/Users/aks3233/Desktop/ChimeraX-1.2.5.app/Contents/Library/Frameworks/Python.framework/Versions/3.8/lib/python3.8/site-
packages/chimerax/graphics/opengl.py", line 478, in make_current  
return self._opengl_context.make_current()  
File
"/Users/aks3233/Desktop/ChimeraX-1.2.5.app/Contents/Library/Frameworks/Python.framework/Versions/3.8/lib/python3.8/site-
packages/chimerax/graphics/opengl.py", line 99, in make_current  
qc = self._initialize_context()  
File
"/Users/aks3233/Desktop/ChimeraX-1.2.5.app/Contents/Library/Frameworks/Python.framework/Versions/3.8/lib/python3.8/site-
packages/chimerax/graphics/opengl.py", line 125, in _initialize_context  
qc.setScreen(self._screen)  
RuntimeError: wrapped C/C++ object of type QScreen has been deleted  
  
RuntimeError: wrapped C/C++ object of type QScreen has been deleted  
  
File
"/Users/aks3233/Desktop/ChimeraX-1.2.5.app/Contents/Library/Frameworks/Python.framework/Versions/3.8/lib/python3.8/site-
packages/chimerax/graphics/opengl.py", line 125, in _initialize_context  
qc.setScreen(self._screen)  
  
See log for complete Python traceback.  
  

Window position QRect(2144,458 100x30) outside any known screen, using primary
screen  




OpenGL version: 4.1 INTEL-14.7.18
OpenGL renderer: Intel Iris Pro OpenGL Engine
OpenGL vendor: Intel Inc.Hardware:

    Hardware Overview:

      Model Name: MacBook Pro
      Model Identifier: MacBookPro11,2
      Processor Name: Quad-Core Intel Core i7
      Processor Speed: 2 GHz
      Number of Processors: 1
      Total Number of Cores: 4
      L2 Cache (per Core): 256 KB
      L3 Cache: 6 MB
      Hyper-Threading Technology: Enabled
      Memory: 8 GB
      Boot ROM Version: 431.140.6.0.0
      SMC Version (system): 2.18f15

Software:

    System Software Overview:

      System Version: macOS 10.15.7 (19H1323)
      Kernel Version: Darwin 19.6.0
      Time since boot: 21 days 7:48

Graphics/Displays:

    Intel Iris Pro:

      Chipset Model: Intel Iris Pro
      Type: GPU
      Bus: Built-In
      VRAM (Dynamic, Max): 1536 MB
      Vendor: Intel
      Device ID: 0x0d26
      Revision ID: 0x0008
      Metal: Supported, feature set macOS GPUFamily1 v4
      Displays:
        Color LCD:
          Display Type: Built-In Retina LCD
          Resolution: 2880 x 1800 Retina
          Framebuffer Depth: 24-Bit Color (ARGB8888)
          Main Display: Yes
          Mirror: Off
          Online: Yes
          Automatically Adjust Brightness: No
          Connection Type: Internal
        DELL ST2320L:
          Resolution: 1920 x 1080 (1080p FHD - Full High Definition)
          UI Looks like: 1920 x 1080 @ 60 Hz
          Framebuffer Depth: 24-Bit Color (ARGB8888)
          Display Serial Number: DFF580C71NFL
          Mirror: Off
          Online: Yes
          Rotation: Supported
          Automatically Adjust Brightness: No

Locale: (None, 'UTF-8')
PyQt5 5.15.2, Qt 5.15.2
Installed Packages:
    alabaster: 0.7.12
    appdirs: 1.4.4
    appnope: 0.1.2
    Babel: 2.9.1
    backcall: 0.2.0
    blockdiag: 2.0.1
    certifi: 2020.12.5
    cftime: 1.5.0
    chardet: 3.0.4
    ChimeraX-AddCharge: 1.0.1
    ChimeraX-AddH: 2.1.6
    ChimeraX-AlignmentAlgorithms: 2.0
    ChimeraX-AlignmentHdrs: 3.2
    ChimeraX-AlignmentMatrices: 2.0
    ChimeraX-Alignments: 2.1
    ChimeraX-AmberInfo: 1.0
    ChimeraX-Arrays: 1.0
    ChimeraX-Atomic: 1.13.2
    ChimeraX-AtomicLibrary: 3.1.3
    ChimeraX-AtomSearch: 2.0
    ChimeraX-AtomSearchLibrary: 1.0
    ChimeraX-AxesPlanes: 2.0
    ChimeraX-BasicActions: 1.1
    ChimeraX-BILD: 1.0
    ChimeraX-BlastProtein: 1.1
    ChimeraX-BondRot: 2.0
    ChimeraX-BugReporter: 1.0
    ChimeraX-BuildStructure: 2.5.2
    ChimeraX-Bumps: 1.0
    ChimeraX-BundleBuilder: 1.1
    ChimeraX-ButtonPanel: 1.0
    ChimeraX-CageBuilder: 1.0
    ChimeraX-CellPack: 1.0
    ChimeraX-Centroids: 1.1
    ChimeraX-ChemGroup: 2.0
    ChimeraX-Clashes: 2.1
    ChimeraX-ColorActions: 1.0
    ChimeraX-ColorGlobe: 1.0
    ChimeraX-ColorKey: 1.2.1
    ChimeraX-CommandLine: 1.1.4
    ChimeraX-ConnectStructure: 2.0
    ChimeraX-Contacts: 1.0
    ChimeraX-Core: 1.2.5
    ChimeraX-CoreFormats: 1.0
    ChimeraX-coulombic: 1.1.1
    ChimeraX-Crosslinks: 1.0
    ChimeraX-Crystal: 1.0
    ChimeraX-CrystalContacts: 1.0
    ChimeraX-DataFormats: 1.1
    ChimeraX-Dicom: 1.0
    ChimeraX-DistMonitor: 1.1.3
    ChimeraX-DistUI: 1.0
    ChimeraX-Dssp: 2.0
    ChimeraX-EMDB-SFF: 1.0
    ChimeraX-ExperimentalCommands: 1.0
    ChimeraX-FileHistory: 1.0
    ChimeraX-FunctionKey: 1.0
    ChimeraX-Geometry: 1.1
    ChimeraX-gltf: 1.0
    ChimeraX-Graphics: 1.0
    ChimeraX-Hbonds: 2.1
    ChimeraX-Help: 1.1
    ChimeraX-HKCage: 1.3
    ChimeraX-IHM: 1.0
    ChimeraX-ImageFormats: 1.1
    ChimeraX-IMOD: 1.0
    ChimeraX-IO: 1.0.1
    ChimeraX-Label: 1.0
    ChimeraX-ListInfo: 1.1.1
    ChimeraX-Log: 1.1.2
    ChimeraX-LookingGlass: 1.1
    ChimeraX-Maestro: 1.8.1
    ChimeraX-Map: 1.0.2
    ChimeraX-MapData: 2.0
    ChimeraX-MapEraser: 1.0
    ChimeraX-MapFilter: 2.0
    ChimeraX-MapFit: 2.0
    ChimeraX-MapSeries: 2.0
    ChimeraX-Markers: 1.0
    ChimeraX-Mask: 1.0
    ChimeraX-MatchMaker: 1.2.1
    ChimeraX-MDcrds: 2.2
    ChimeraX-MedicalToolbar: 1.0.1
    ChimeraX-Meeting: 1.0
    ChimeraX-MLP: 1.1
    ChimeraX-mmCIF: 2.3
    ChimeraX-MMTF: 2.1
    ChimeraX-Modeller: 1.0.1
    ChimeraX-ModelPanel: 1.0.1
    ChimeraX-ModelSeries: 1.0
    ChimeraX-Mol2: 2.0
    ChimeraX-Morph: 1.0
    ChimeraX-MouseModes: 1.1
    ChimeraX-Movie: 1.0
    ChimeraX-Neuron: 1.0
    ChimeraX-Nucleotides: 2.0.1
    ChimeraX-OpenCommand: 1.5
    ChimeraX-PDB: 2.4.1
    ChimeraX-PDBBio: 1.0
    ChimeraX-PDBLibrary: 1.0.1
    ChimeraX-PDBMatrices: 1.0
    ChimeraX-PickBlobs: 1.0
    ChimeraX-Positions: 1.0
    ChimeraX-PresetMgr: 1.0.1
    ChimeraX-PubChem: 2.0.1
    ChimeraX-ReadPbonds: 1.0
    ChimeraX-Registration: 1.1
    ChimeraX-RemoteControl: 1.0
    ChimeraX-ResidueFit: 1.0
    ChimeraX-RestServer: 1.1
    ChimeraX-RNALayout: 1.0
    ChimeraX-RotamerLibMgr: 2.0
    ChimeraX-RotamerLibsDunbrack: 2.0
    ChimeraX-RotamerLibsDynameomics: 2.0
    ChimeraX-RotamerLibsRichardson: 2.0
    ChimeraX-SaveCommand: 1.4
    ChimeraX-SchemeMgr: 1.0
    ChimeraX-SDF: 2.0
    ChimeraX-Segger: 1.0
    ChimeraX-Segment: 1.0
    ChimeraX-SeqView: 2.3
    ChimeraX-Shape: 1.0.1
    ChimeraX-Shell: 1.0
    ChimeraX-Shortcuts: 1.0
    ChimeraX-ShowAttr: 1.0
    ChimeraX-ShowSequences: 1.0
    ChimeraX-SideView: 1.0
    ChimeraX-Smiles: 2.0.1
    ChimeraX-SmoothLines: 1.0
    ChimeraX-SpaceNavigator: 1.0
    ChimeraX-StdCommands: 1.3.1
    ChimeraX-STL: 1.0
    ChimeraX-Storm: 1.0
    ChimeraX-Struts: 1.0
    ChimeraX-Surface: 1.0
    ChimeraX-SwapAA: 2.0
    ChimeraX-SwapRes: 2.1
    ChimeraX-TapeMeasure: 1.0
    ChimeraX-Test: 1.0
    ChimeraX-Toolbar: 1.0.1
    ChimeraX-ToolshedUtils: 1.2
    ChimeraX-Tug: 1.0
    ChimeraX-UI: 1.7.6
    ChimeraX-uniprot: 2.1
    ChimeraX-UnitCell: 1.0
    ChimeraX-ViewDockX: 1.0
    ChimeraX-Vive: 1.1
    ChimeraX-VolumeMenu: 1.0
    ChimeraX-VTK: 1.0
    ChimeraX-WavefrontOBJ: 1.0
    ChimeraX-WebCam: 1.0
    ChimeraX-WebServices: 1.0
    ChimeraX-Zone: 1.0
    colorama: 0.4.3
    comtypes: 1.1.7
    cxservices: 1.0
    cycler: 0.10.0
    Cython: 0.29.21
    decorator: 5.0.9
    distlib: 0.3.1
    docutils: 0.16
    filelock: 3.0.12
    funcparserlib: 0.3.6
    grako: 3.16.5
    h5py: 2.10.0
    html2text: 2020.1.16
    idna: 2.10
    ihm: 0.17
    imagecodecs: 2020.5.30
    imagesize: 1.2.0
    ipykernel: 5.3.4
    ipython: 7.18.1
    ipython-genutils: 0.2.0
    jedi: 0.17.2
    Jinja2: 2.11.2
    jupyter-client: 6.1.7
    jupyter-core: 4.7.1
    kiwisolver: 1.3.1
    line-profiler: 2.1.2
    lxml: 4.6.2
    lz4: 3.1.0
    MarkupSafe: 2.0.1
    matplotlib: 3.3.2
    matplotlib-inline: 0.1.2
    msgpack: 1.0.0
    netCDF4: 1.5.4
    networkx: 2.5
    numexpr: 2.7.3
    numpy: 1.19.2
    numpydoc: 1.1.0
    openvr: 1.14.1501
    packaging: 20.9
    ParmEd: 3.2.0
    parso: 0.7.1
    pexpect: 4.8.0
    pickleshare: 0.7.5
    Pillow: 7.2.0
    pip: 21.0.1
    pkginfo: 1.5.0.1
    prompt-toolkit: 3.0.18
    psutil: 5.7.2
    ptyprocess: 0.7.0
    pycollada: 0.7.1
    pydicom: 2.0.0
    Pygments: 2.7.1
    PyOpenGL: 3.1.5
    PyOpenGL-accelerate: 3.1.5
    pyparsing: 2.4.7
    PyQt5-commercial: 5.15.2
    PyQt5-sip: 12.8.1
    PyQtWebEngine-commercial: 5.15.2
    python-dateutil: 2.8.1
    pytz: 2021.1
    pyzmq: 22.0.3
    qtconsole: 4.7.7
    QtPy: 1.9.0
    RandomWords: 0.3.0
    requests: 2.24.0
    scipy: 1.5.2
    setuptools: 50.3.2
    sfftk-rw: 0.6.7.dev1
    six: 1.15.0
    snowballstemmer: 2.1.0
    sortedcontainers: 2.2.2
    Sphinx: 3.2.1
    sphinxcontrib-applehelp: 1.0.2
    sphinxcontrib-blockdiag: 2.0.0
    sphinxcontrib-devhelp: 1.0.2
    sphinxcontrib-htmlhelp: 2.0.0
    sphinxcontrib-jsmath: 1.0.1
    sphinxcontrib-qthelp: 1.0.3
    sphinxcontrib-serializinghtml: 1.1.5
    suds-jurko: 0.6
    tables: 3.6.1
    tifffile: 2020.9.3
    tinyarray: 1.2.3
    tornado: 6.1
    traitlets: 5.0.5
    urllib3: 1.25.11
    wcwidth: 0.2.5
    webcolors: 1.11.1
    wheel: 0.36.0
    wheel-filename: 1.3.0

Change History (2)

comment:1 by Eric Pettersen, 5 years ago

Component: UnassignedWindow Toolkit
Owner: set to Tom Goddard
Platform: all
Project: ChimeraX
Status: newassigned
Summary: ChimeraX bug report submissionDual display problem

comment:2 by Eric Pettersen, 5 years ago

Resolution: duplicate
Status: assignedclosed
Note: See TracTickets for help on using tickets.