Opened 5 years ago

Closed 5 years ago

#6036 closed defect (can't reproduce)

Crash in Qt event loop after "view sel" command, 10 year old graphics, Windows

Reported by: chimerax-bug-report@… Owned by: Tom Goddard
Priority: normal Milestone:
Component: Window Toolkit Version:
Keywords: Cc: Eric Pettersen
Blocked By: Blocking:
Notify when closed: Platform: all
Project: ChimeraX

Description

The following bug report has been submitted:
Platform:        Windows-10-10.0.19044
ChimeraX Version: 1.3 (2021-12-08 23:08:33 UTC)
Description
Last time you used ChimeraX it crashed.
Please describe steps that led to the crash here.
Windows fatal exception: code 0x8001010d

Thread 0x000039a0 (most recent call first):
  File "C:\Program Files\ChimeraX 1.3\bin\lib\multiprocessing\pool.py", line 576 in _handle_results
  File "C:\Program Files\ChimeraX 1.3\bin\lib\threading.py", line 910 in run
  File "C:\Program Files\ChimeraX 1.3\bin\lib\threading.py", line 973 in _bootstrap_inner
  File "C:\Program Files\ChimeraX 1.3\bin\lib\threading.py", line 930 in _bootstrap

Thread 0x00001534 (most recent call first):
  File "C:\Program Files\ChimeraX 1.3\bin\lib\multiprocessing\pool.py", line 528 in _handle_tasks
  File "C:\Program Files\ChimeraX 1.3\bin\lib\threading.py", line 910 in run
  File "C:\Program Files\ChimeraX 1.3\bin\lib\threading.py", line 973 in _bootstrap_inner
  File "C:\Program Files\ChimeraX 1.3\bin\lib\threading.py", line 930 in _bootstrap

Thread 0x00001b60 (most recent call first):
  File "C:\Program Files\ChimeraX 1.3\bin\lib\multiprocessing\connection.py", line 816 in _exhaustive_wait
  File "C:\Program Files\ChimeraX 1.3\bin\lib\multiprocessing\connection.py", line 884 in wait
  File "C:\Program Files\ChimeraX 1.3\bin\lib\multiprocessing\pool.py", line 499 in _wait_for_updates
  File "C:\Program Files\ChimeraX 1.3\bin\lib\multiprocessing\pool.py", line 519 in _handle_workers
  File "C:\Program Files\ChimeraX 1.3\bin\lib\threading.py", line 910 in run
  File "C:\Program Files\ChimeraX 1.3\bin\lib\threading.py", line 973 in _bootstrap_inner
  File "C:\Program Files\ChimeraX 1.3\bin\lib\threading.py", line 930 in _bootstrap

Thread 0x0000042c (most recent call first):
  File "C:\Program Files\ChimeraX 1.3\bin\lib\multiprocessing\pool.py", line 114 in worker
  File "C:\Program Files\ChimeraX 1.3\bin\lib\threading.py", line 910 in run
  File "C:\Program Files\ChimeraX 1.3\bin\lib\threading.py", line 973 in _bootstrap_inner
  File "C:\Program Files\ChimeraX 1.3\bin\lib\threading.py", line 930 in _bootstrap

Thread 0x0000305c (most recent call first):
  File "C:\Program Files\ChimeraX 1.3\bin\lib\multiprocessing\pool.py", line 114 in worker
  File "C:\Program Files\ChimeraX 1.3\bin\lib\threading.py", line 910 in run
  File "C:\Program Files\ChimeraX 1.3\bin\lib\threading.py", line 973 in _bootstrap_inner
  File "C:\Program Files\ChimeraX 1.3\bin\lib\threading.py", line 930 in _bootstrap

Thread 0x000008c4 (most recent call first):
  File "C:\Program Files\ChimeraX 1.3\bin\lib\multiprocessing\pool.py", line 114 in worker
  File "C:\Program Files\ChimeraX 1.3\bin\lib\threading.py", line 910 in run
  File "C:\Program Files\ChimeraX 1.3\bin\lib\threading.py", line 973 in _bootstrap_inner
  File "C:\Program Files\ChimeraX 1.3\bin\lib\threading.py", line 930 in _bootstrap

Thread 0x00000f00 (most recent call first):
  File "C:\Program Files\ChimeraX 1.3\bin\lib\multiprocessing\pool.py", line 114 in worker
  File "C:\Program Files\ChimeraX 1.3\bin\lib\threading.py", line 910 in run
  File "C:\Program Files\ChimeraX 1.3\bin\lib\threading.py", line 973 in _bootstrap_inner
  File "C:\Program Files\ChimeraX 1.3\bin\lib\threading.py", line 930 in _bootstrap

Thread 0x00001914 (most recent call first):
  File "C:\Program Files\ChimeraX 1.3\bin\lib\multiprocessing\pool.py", line 114 in worker
  File "C:\Program Files\ChimeraX 1.3\bin\lib\threading.py", line 910 in run
  File "C:\Program Files\ChimeraX 1.3\bin\lib\threading.py", line 973 in _bootstrap_inner
  File "C:\Program Files\ChimeraX 1.3\bin\lib\threading.py", line 930 in _bootstrap

Thread 0x00002780 (most recent call first):
  File "C:\Program Files\ChimeraX 1.3\bin\lib\multiprocessing\pool.py", line 114 in worker
  File "C:\Program Files\ChimeraX 1.3\bin\lib\threading.py", line 910 in run
  File "C:\Program Files\ChimeraX 1.3\bin\lib\threading.py", line 973 in _bootstrap_inner
  File "C:\Program Files\ChimeraX 1.3\bin\lib\threading.py", line 930 in _bootstrap

Thread 0x00003acc (most recent call first):
  File "C:\Program Files\ChimeraX 1.3\bin\lib\multiprocessing\pool.py", line 114 in worker
  File "C:\Program Files\ChimeraX 1.3\bin\lib\threading.py", line 910 in run
  File "C:\Program Files\ChimeraX 1.3\bin\lib\threading.py", line 973 in _bootstrap_inner
  File "C:\Program Files\ChimeraX 1.3\bin\lib\threading.py", line 930 in _bootstrap

Thread 0x0000078c (most recent call first):
  File "C:\Program Files\ChimeraX 1.3\bin\lib\multiprocessing\pool.py", line 114 in worker
  File "C:\Program Files\ChimeraX 1.3\bin\lib\threading.py", line 910 in run
  File "C:\Program Files\ChimeraX 1.3\bin\lib\threading.py", line 973 in _bootstrap_inner
  File "C:\Program Files\ChimeraX 1.3\bin\lib\threading.py", line 930 in _bootstrap

Current thread 0x00001da0 (most recent call first):
  File "C:\Program Files\ChimeraX 1.3\bin\lib\site-packages\chimerax\ui\gui.py", line 301 in event_loop
  File "C:\Program Files\ChimeraX 1.3\bin\lib\site-packages\ChimeraX_main.py", line 867 in init
  File "C:\Program Files\ChimeraX 1.3\bin\lib\site-packages\ChimeraX_main.py", line 1018 in 
  File "C:\Program Files\ChimeraX 1.3\bin\lib\runpy.py", line 87 in _run_code
  File "C:\Program Files\ChimeraX 1.3\bin\lib\runpy.py", line 197 in _run_module_as_main
===== Log before crash start =====
Startup Messages  
---  
note | available bundle cache has not been initialized yet  
  
UCSF ChimeraX version: 1.3 (2021-12-08)  
© 2016-2021 Regents of the University of California. All rights reserved.  
How to cite UCSF ChimeraX  

> ui tool show Registration

Thank you for registering your copy of ChimeraX. By providing the information
requested you will be helping us document the impact this software is having
in the scientific community. The information you supplied will only be used
for reporting summary usage statistics; no individual data will be released.  
flbarroso@usp.br is subscribed to the ChimeraX announcements list  

> open
> C:/Users/flbar/Dropbox/Casa_Trabalho/Attract/code/Spike_wt_DDD_S230/CR3022_short_6w41_for_haddock.pdb

Summary of feedback from opening
C:/Users/flbar/Dropbox/Casa_Trabalho/Attract/code/Spike_wt_DDD_S230/CR3022_short_6w41_for_haddock.pdb  
---  
warnings | Cannot find LINK/SSBOND residue CYS (140 )  
Cannot find LINK/SSBOND residue CYS (216 )  
Cannot find LINK/SSBOND residue CYS (23 )  
Cannot find LINK/SSBOND residue CYS (194 )  
Cannot find LINK/SSBOND residue CYS (336 )  
4 messages similar to the above omitted  
  
CR3022_short_6w41_for_haddock.pdb title:  
Crystal structure of sars-cov-2 receptor binding domain In complex with human
antibody CR3022 [more info...]  
  
Chain information for CR3022_short_6w41_for_haddock.pdb #1  
---  
Chain | Description  
H | CR3022 fab heavy chain  
L | CR3022 fab light chain  
  

> style sphere

Changed 1688 atom styles  

> show surfaces

> color bychain

> coulombic

Using Amber 20 recommended default charges and atom types for standard
residues  
Coulombic values for CR3022_short_6w41_for_haddock.pdb_H SES surface #1.1:
minimum, -14.12, mean -0.19, maximum 9.15  
Coulombic values for CR3022_short_6w41_for_haddock.pdb_L SES surface #1.2:
minimum, -10.66, mean -0.05, maximum 8.70  
To also show corresponding color key, enter the above coulombic command and
add key true  

> mlp

Map values for surface "CR3022_short_6w41_for_haddock.pdb_H SES surface":
minimum -27.12, mean -4.866, maximum 23.44  
Map values for surface "CR3022_short_6w41_for_haddock.pdb_L SES surface":
minimum -27.15, mean -5.28, maximum 21.9  
To also show corresponding color key, enter the above mlp command and add key
true  

> color bfactor

1688 atoms, 218 residues, 2 surfaces, atom bfactor range 48 to 173  

> style sphere

Changed 1688 atom styles  

> preset cartoons/nucleotides ribbons/slabs

Changed 1688 atom styles  
Preset expands to these ChimeraX commands:

    
    
    show nucleic
    hide protein|solvent|H
    surf hide
    style (protein|nucleic|solvent) & @@draw_mode=0 stick
    cartoon
    cartoon style modeh def arrows t arrowshelix f arrowscale 2 wid 2 thick 0.4 sides 12 div 20
    cartoon style ~(nucleic|strand) x round
    cartoon style (nucleic|strand) x rect
    nucleotides tube/slab shape box

  

> preset cartoons/nucleotides cylinders/stubs

Changed 0 atom styles  
Preset expands to these ChimeraX commands:

    
    
    show nucleic
    hide protein|solvent|H
    surf hide
    style (protein|nucleic|solvent) & @@draw_mode=0 stick
    cartoon
    cartoon style modeh def arrows t arrowshelix f arrowscale 2 wid 2 thick 0.4 sides 12 div 20
    cartoon style ~(nucleic|strand) x round
    cartoon style (nucleic|strand) x rect
    cartoon style protein modeh tube rad 2 sides 24 thick 0.6
    cartoon style nucleic x round width 1.6 thick 1.6
    nucleotides stubs

  

> preset cartoons/nucleotides licorice/ovals

Changed 0 atom styles  
Preset expands to these ChimeraX commands:

    
    
    show nucleic
    hide protein|solvent|H
    surf hide
    style (protein|nucleic|solvent) & @@draw_mode=0 stick
    cartoon
    cartoon style modeh def arrows t arrowshelix f arrowscale 2 wid 2 thick 0.4 sides 12 div 20
    cartoon style ~(nucleic|strand) x round
    cartoon style (nucleic|strand) x rect
    cartoon style protein modeh default arrows f x round width 1 thick 1
    cartoon style nucleic x round width 1.6 thick 1.6
    nucleotides tube/slab shape ellipsoid

  

> preset "initial styles" "original look"

Preset implemented in Python; no expansion to individual ChimeraX commands
available.  

> preset "initial styles" "space-filling (chain colors)"

Preset implemented in Python; no expansion to individual ChimeraX commands
available.  

> preset "initial styles" "space-filling (single color)"

Preset implemented in Python; no expansion to individual ChimeraX commands
available.  

> preset "molecular surfaces" "atomic coloring (transparent)"

Changed 1688 atom styles  
Preset expands to these ChimeraX commands:

    
    
    style (protein|nucleic|solvent) & @@draw_mode=0 stick
    surface
    color fromatoms targ s trans 70

  

> preset "overall look" publication

Preset expands to these ChimeraX commands:

    
    
    set bg white
    graphics silhouettes t

  

> preset "overall look" interactive

Preset expands to these ChimeraX commands:

    
    
    ~set bg
    graphics silhouettes f

  

> color #1 #aa0000 transparency 0

> hide surfaces

> nucleotides fill

> style nucleic stick

Changed 0 atom styles  

> show surfaces

> nucleotides fill

> style nucleic stick

Changed 0 atom styles  

> nucleotides tube/slab shape box

> nucleotides atoms

> style nucleic stick

Changed 0 atom styles  

> show surfaces

> color bychain

> close session

QWindowsNativeFileDialogBase::shellItem : Unhandled scheme: "data"  

> open
> C:/Users/flbar/Dropbox/Casa_Trabalho/000_Paper_Abs/Structures_Modeller/6nb6.pdb

6nb6.pdb title:  
Sars-cov complex with human neutralizing S230 antibody fab fragment (state 1)
[more info...]  
  
Chain information for 6nb6.pdb #1  
---  
Chain | Description | UniProt  
A | spike glycoprotein | SPIKE_CVHSA  
B | spike glycoprotein | SPIKE_CVHSA  
C | spike glycoprotein | SPIKE_CVHSA  
H | S230 heavy chain |  
I | S230 heavy chain |  
L | S230 light chain |  
M | S230 light chain |  
  

> select /I:1-124

618 atoms, 621 bonds, 124 residues, 1 model selected  

> select /I:1-124

618 atoms, 621 bonds, 124 residues, 1 model selected  

> select /I:1-124

618 atoms, 621 bonds, 124 residues, 1 model selected  

> select /H:2-124

613 atoms, 616 bonds, 123 residues, 1 model selected  

> select /H:2-124

613 atoms, 616 bonds, 123 residues, 1 model selected  

> select /H:2-124

613 atoms, 616 bonds, 123 residues, 1 model selected  

> select /H:2-124

613 atoms, 616 bonds, 123 residues, 1 model selected  

> select /L:3-112

557 atoms, 565 bonds, 110 residues, 1 model selected  

> select /M:3-111

552 atoms, 560 bonds, 109 residues, 1 model selected  

> select /L:3-112

557 atoms, 565 bonds, 110 residues, 1 model selected  

> select /M:3-111

552 atoms, 560 bonds, 109 residues, 1 model selected  

> select /L:3-112

557 atoms, 565 bonds, 110 residues, 1 model selected  

> select /I:1-124

618 atoms, 621 bonds, 124 residues, 1 model selected  

> select /H:2-124

613 atoms, 616 bonds, 123 residues, 1 model selected  

> color sel red

> select /H:2-124

613 atoms, 616 bonds, 123 residues, 1 model selected  

> select /I:1-124

618 atoms, 621 bonds, 124 residues, 1 model selected  

> select /L:3-112

557 atoms, 565 bonds, 110 residues, 1 model selected  

> select /M:3-111

552 atoms, 560 bonds, 109 residues, 1 model selected  

> select /H:2-124

613 atoms, 616 bonds, 123 residues, 1 model selected  

> select /L:3-112

557 atoms, 565 bonds, 110 residues, 1 model selected  

> color sel orange red

> select /L:3-112

557 atoms, 565 bonds, 110 residues, 1 model selected  

> select /L:3-112

557 atoms, 565 bonds, 110 residues, 1 model selected  

> select /L:3-112

557 atoms, 565 bonds, 110 residues, 1 model selected  

> select /M:3-111

552 atoms, 560 bonds, 109 residues, 1 model selected  

> color sel yellow

> select /M:3-111

552 atoms, 560 bonds, 109 residues, 1 model selected  

> select /M:3-111

552 atoms, 560 bonds, 109 residues, 1 model selected  

> select /L:3-112

557 atoms, 565 bonds, 110 residues, 1 model selected  

> select /H:2-124

613 atoms, 616 bonds, 123 residues, 1 model selected  

> select /I:1-124

618 atoms, 621 bonds, 124 residues, 1 model selected  

> select /L:3-112

557 atoms, 565 bonds, 110 residues, 1 model selected  

> select /L:3-112

557 atoms, 565 bonds, 110 residues, 1 model selected  

> color sel lime

> select /H:2-124

613 atoms, 616 bonds, 123 residues, 1 model selected  

> select /H:2-124

613 atoms, 616 bonds, 123 residues, 1 model selected  

> select /L:3-112

557 atoms, 565 bonds, 110 residues, 1 model selected  

> select /H:2-124

613 atoms, 616 bonds, 123 residues, 1 model selected  

> select /M:3-111

552 atoms, 560 bonds, 109 residues, 1 model selected  

> select /I:1-124

618 atoms, 621 bonds, 124 residues, 1 model selected  

> color sel lime

> select /H:2-124

613 atoms, 616 bonds, 123 residues, 1 model selected  

> select /I:1-124

618 atoms, 621 bonds, 124 residues, 1 model selected  

> select /L:3-112

557 atoms, 565 bonds, 110 residues, 1 model selected  

> color sel orange

> nucleotides sel atoms

> style nucleic & sel stick

Changed 0 atom styles  

> nucleotides sel fill

> style nucleic & sel stick

Changed 0 atom styles  

> show sel surfaces

> select /H:2-124

613 atoms, 616 bonds, 123 residues, 1 model selected  

> show sel surfaces

> select /I:1-124

618 atoms, 621 bonds, 124 residues, 1 model selected  

> show sel surfaces

> select /M:3-111

552 atoms, 560 bonds, 109 residues, 1 model selected  

> show sel surfaces

> select clear

> set bgColor white

> lighting simple

> lighting soft

> lighting full

> lighting flat

> graphics silhouettes false

> view

> ui tool show "Side View"

> view

> view orient

> view

> lighting full

> view

> view orient

> view

> select #1

25783 atoms, 26444 bonds, 22 pseudobonds, 3748 residues, 2 models selected  

> ~select #1

4 models selected  

> hide #!1 models

> show #!1 models

> show surfaces

> cofr frontCenter

> close session

> open
> C:\Users\flbar\Dropbox\Casa_Trabalho\000_Paper_Abs\Structures_Modeller\6nb6.pdb
> format pdb

6nb6.pdb title:  
Sars-cov complex with human neutralizing S230 antibody fab fragment (state 1)
[more info...]  
  
Chain information for 6nb6.pdb #1  
---  
Chain | Description | UniProt  
A | spike glycoprotein | SPIKE_CVHSA  
B | spike glycoprotein | SPIKE_CVHSA  
C | spike glycoprotein | SPIKE_CVHSA  
H | S230 heavy chain |  
I | S230 heavy chain |  
L | S230 light chain |  
M | S230 light chain |  
  

> lighting soft

> lighting flat

> lighting full

> graphics silhouettes false

> graphics silhouettes true

> lighting flat

> view orient

> view

> ui tool show "Side View"

> volume style surface

No volumes specified  

> volume showOutlineBox true

No volumes specified  

> transparency 50

Fit in map shortcut requires 1 displayed atomic model and 1 map or two maps,
got 1 atomic models, 0 maps.  

> ui mousemode right "rotate slab"

> ui tool show "Selection Inspector"

> lighting simple

> lighting soft

> lighting full

> lighting soft

> interfaces ~solvent

5 buried areas: A C 4281, A B 3765, C B 3540, I M 388, H L 376  

> ui tool show "Selection Inspector"

> ui tool show "Side View"

> view

> ui mousemode right "rotate selected models"

> ui mousemode right rotate

> ui mousemode right "contour level"

> ui mousemode right "rotate slab"

> close session

> toolshed show

> ui tool show AlphaFold

> select sequence KKKYAEGH

Nothing selected  

> ui tool show AlphaFold

No sequence chosen for AlphaFold predict  

> alphafold predict
> EIVLTQSPGTLSLSPGERATLSCRASQTVSSTSLAWYQQKPGQAPRLLIYGASSRATGIPDRFSGSGSGTDFTLTISRLEPEDFAVYYCMQGTHWPPTSLTFGGGTKVEIK

Running AlphaFold prediction  

> open
> C:/Users/flbar/Dropbox/Casa_Trabalho/000_Paper_Abs/Structures_Modeller/Top5.pdb

Summary of feedback from opening
C:/Users/flbar/Dropbox/Casa_Trabalho/000_Paper_Abs/Structures_Modeller/Top5.pdb  
---  
warnings | Cannot find LINK/SSBOND residue NAG (1303 )  
Cannot find LINK/SSBOND residue NAG (1301 )  
Cannot find LINK/SSBOND residue NAG (1302 )  
Cannot find LINK/SSBOND residue NAG (1304 )  
Cannot find LINK/SSBOND residue NAG (1305 )  
48 messages similar to the above omitted  
Start residue of secondary structure not found: HELIX 1 1 PRO A 295 THR A 302
1 8  
Start residue of secondary structure not found: HELIX 2 2 GLY A 339 PHE A 342
1 4  
Start residue of secondary structure not found: HELIX 3 3 VAL A 350 ALA A 352
1 3  
Start residue of secondary structure not found: HELIX 4 4 TYR A 365 TYR A 369
1 5  
Start residue of secondary structure not found: HELIX 5 5 LEU A 387 ASP A 389
1 3  
58 messages similar to the above omitted  
End residue of secondary structure not found: HELIX 64 64 SER L 26 GLY L 30 1
5  
Start residue of secondary structure not found: HELIX 65 65 SER L 81 ASP L 83
1 3  
Start residue of secondary structure not found: HELIX 66 66 THR D 88 ASP D 90
1 3  
Start residue of secondary structure not found: HELIX 67 67 SER E 26 GLY E 30
1 5  
Start residue of secondary structure not found: HELIX 68 68 THR F 88 ASP F 90
1 3  
Start residue of secondary structure not found: HELIX 69 69 SER G 26 GLY G 30
1 5  
155 messages similar to the above omitted  
End residue of secondary structure not found: SHEET 157 157 1 THR H 116 VAL H
118 0  
Start residue of secondary structure not found: SHEET 158 158 1 SER L 9 SER L
11 0  
Start residue of secondary structure not found: SHEET 159 159 1 VAL L 18 SER L
23 0  
Start residue of secondary structure not found: SHEET 160 160 1 VAL L 34 HIS L
39 0  
Start residue of secondary structure not found: SHEET 161 161 1 LYS L 46 ILE L
49 0  
Start residue of secondary structure not found: SHEET 162 162 1 PHE L 63 SER L
68 0  
102 messages similar to the above omitted  
End residue of secondary structure not found: HELIX 64 64 SER L 26 GLY L 30 1
5  
End residue of secondary structure not found: HELIX 65 65 SER L 81 ASP L 83 1
3  
Start residue of secondary structure not found: HELIX 66 66 THR D 88 ASP D 90
1 3  
Start residue of secondary structure not found: HELIX 67 67 SER E 26 GLY E 30
1 5  
Start residue of secondary structure not found: HELIX 68 68 THR F 88 ASP F 90
1 3  
Start residue of secondary structure not found: HELIX 69 69 SER G 26 GLY G 30
1 5  
Start residue of secondary structure not found: HELIX 70 70 SER G 81 ASP G 83
1 3  
150 messages similar to the above omitted  
End residue of secondary structure not found: SHEET 154 154 1 PHE H 68 ASP H
73 0  
Start residue of secondary structure not found: SHEET 155 155 1 SER H 78 MET H
83 0  
End residue of secondary structure not found: SHEET 156 156 1 ALA H 92 LYS H
98 0  
Start residue of secondary structure not found: SHEET 157 157 1 THR H 116 VAL
H 118 0  
Start residue of secondary structure not found: SHEET 158 158 1 SER L 9 SER L
11 0  
Start residue of secondary structure not found: SHEET 159 159 1 VAL L 18 SER L
23 0  
Start residue of secondary structure not found: SHEET 160 160 1 VAL L 34 HIS L
39 0  
Start residue of secondary structure not found: SHEET 161 161 1 LYS L 46 ILE L
49 0  
103 messages similar to the above omitted  
End residue of secondary structure not found: HELIX 64 64 SER L 26 GLY L 30 1
5  
End residue of secondary structure not found: HELIX 65 65 SER L 81 ASP L 83 1
3  
Start residue of secondary structure not found: HELIX 66 66 THR D 88 ASP D 90
1 3  
Start residue of secondary structure not found: HELIX 67 67 SER E 26 GLY E 30
1 5  
Start residue of secondary structure not found: HELIX 68 68 THR F 88 ASP F 90
1 3  
Start residue of secondary structure not found: HELIX 69 69 SER G 26 GLY G 30
1 5  
Start residue of secondary structure not found: HELIX 70 70 SER G 81 ASP G 83
1 3  
149 messages similar to the above omitted  
End residue of secondary structure not found: SHEET 152 152 1 GLU H 46 ILE H
51 0  
Start residue of secondary structure not found: SHEET 153 153 1 ILE H 58 TYR H
60 0  
Start residue of secondary structure not found: SHEET 154 154 1 PHE H 68 ASP H
73 0  
Start residue of secondary structure not found: SHEET 155 155 1 SER H 78 MET H
83 0  
End residue of secondary structure not found: SHEET 156 156 1 ALA H 92 LYS H
98 0  
Start residue of secondary structure not found: SHEET 157 157 1 THR H 116 VAL
H 118 0  
Start residue of secondary structure not found: SHEET 158 158 1 SER L 9 SER L
11 0  
Start residue of secondary structure not found: SHEET 159 159 1 VAL L 18 SER L
23 0  
Start residue of secondary structure not found: SHEET 160 160 1 VAL L 34 HIS L
39 0  
Start residue of secondary structure not found: SHEET 161 161 1 LYS L 46 ILE L
49 0  
362 messages similar to the above omitted  
End residue of secondary structure not found: HELIX 64 64 SER L 26 GLY L 30 1
5  
Start residue of secondary structure not found: HELIX 65 65 SER L 81 ASP L 83
1 3  
Start residue of secondary structure not found: HELIX 66 66 THR D 88 ASP D 90
1 3  
Start residue of secondary structure not found: HELIX 67 67 SER E 26 GLY E 30
1 5  
Start residue of secondary structure not found: HELIX 68 68 THR F 88 ASP F 90
1 3  
Start residue of secondary structure not found: HELIX 69 69 SER G 26 GLY G 30
1 5  
104 messages similar to the above omitted  
End residue of secondary structure not found: SHEET 104 104 1 GLY C 103 GLY C
107 0  
Start residue of secondary structure not found: SHEET 105 105 1 SER C 116 ASN
C 122 0  
Start residue of secondary structure not found: SHEET 106 106 1 ASN C 125 CYS
C 131 0  
Start residue of secondary structure not found: SHEET 107 107 1 CYS C 166 TYR
C 170 0  
Start residue of secondary structure not found: SHEET 108 108 1 ASN C 188 ILE
C 197 0  
End residue of secondary structure not found: SHEET 109 109 1 TYR C 200 PRO C
209 0  
Start residue of secondary structure not found: SHEET 110 110 1 GLU C 224 PRO
C 230 0  
Start residue of secondary structure not found: SHEET 111 111 1 ARG C 237 LEU
C 241 0  
Start residue of secondary structure not found: SHEET 112 112 1 TYR C 265 TYR
C 269 0  
Start residue of secondary structure not found: SHEET 113 113 1 GLN C 271 TYR
C 279 0  
Start residue of secondary structure not found: SHEET 114 114 1 ILE C 285 ASP
C 290 0  
38 messages similar to the above omitted  
End residue of secondary structure not found: SHEET 157 157 1 THR H 116 VAL H
118 0  
End residue of secondary structure not found: SHEET 158 158 1 SER L 9 SER L 11
0  
Start residue of secondary structure not found: SHEET 159 159 1 VAL L 18 SER L
23 0  
Start residue of secondary structure not found: SHEET 160 160 1 VAL L 34 HIS L
39 0  
Start residue of secondary structure not found: SHEET 161 161 1 LYS L 46 ILE L
49 0  
Start residue of secondary structure not found: SHEET 162 162 1 PHE L 63 SER L
68 0  
Start residue of secondary structure not found: SHEET 163 163 1 SER L 71 ILE L
76 0  
2 messages similar to the above omitted  
End residue of secondary structure not found: SHEET 166 166 1 LYS L 105 THR L
107 0  
Start residue of secondary structure not found: SHEET 167 167 1 GLN D 3 SER D
7 0  
Start residue of secondary structure not found: SHEET 168 168 1 LEU D 18 SER D
25 0  
Start residue of secondary structure not found: SHEET 169 169 1 MET D 34 GLN D
39 0  
Start residue of secondary structure not found: SHEET 170 170 1 LEU D 45 ILE D
51 0  
Start residue of secondary structure not found: SHEET 171 171 1 ILE D 58 TYR D
60 0  
30 messages similar to the above omitted  
  
Top5.pdb title:  
Sars-cov-2 spike In complex with the S2K146 neutralizing antibody fab fragment
(two receptor-binding domains open) [more info...]  
  
Chain information for Top5.pdb  
---  
Chain | Description | UniProt  
1.1/A | spike glycoprotein | SPIKE_SARS2  
1.5/A | spike glycoprotein | SPIKE_SARS2  
1.1/B | spike glycoprotein | SPIKE_SARS2  
1.5/B | spike glycoprotein | SPIKE_SARS2  
1.1/C | spike glycoprotein | SPIKE_SARS2  
1.5/C | spike glycoprotein | SPIKE_SARS2  
1.6/C | spike glycoprotein | SPIKE_SARS2  
1.1/D 1.1/F 1.1/H | S2K146 fab heavy chain |  
1.6/D | S2K146 fab heavy chain |  
1.1/E | S2K146 fab light chain |  
1.1/G 1.1/L | S2K146 fab light chain |  
1.2/H | S2K146 fab heavy chain |  
1.3/H | S2K146 fab heavy chain |  
1.4/H | S2K146 fab heavy chain |  
1.6/H | S2K146 fab heavy chain |  
1.3/I | No description available |  
1.4/I 1.4/J | No description available |  
1.2/L | S2K146 fab light chain |  
1.3/L | S2K146 fab light chain |  
1.4/L | S2K146 fab light chain |  
1.6/L | S2K146 fab light chain |  
1.3/M | No description available |  
1.4/M 1.4/N | No description available |  
  

> hide #1.3 models

> show #1.3 models

> hide #1.5 models

> show #1.5 models

> hide #1.3 models

> hide #1.4 models

> hide #1.5 models

> hide #1.6 models

> hide #1.2 models

> hide #!1.1 models

> show #!1.1 models

> hide #!1.1 models

> show #1.3 models

> show #1.3 surfaces

> show #!1.1 models

> show #1.2 models

> close session

> open
> C:/Users/flbar/Dropbox/Casa_Trabalho/000_Paper_Abs/Structures_Modeller/Top5_7tat.pdb

Summary of feedback from opening
C:/Users/flbar/Dropbox/Casa_Trabalho/000_Paper_Abs/Structures_Modeller/Top5_7tat.pdb  
---  
warnings | Cannot find LINK/SSBOND residue NAG (1303 )  
Cannot find LINK/SSBOND residue NAG (1301 )  
Cannot find LINK/SSBOND residue NAG (1302 )  
Cannot find LINK/SSBOND residue NAG (1304 )  
Cannot find LINK/SSBOND residue NAG (1305 )  
48 messages similar to the above omitted  
  
Top5_7tat.pdb title:  
Sars-cov-2 spike In complex with the S2K146 neutralizing antibody fab fragment
(two receptor-binding domains open) [more info...]  
  
Chain information for Top5_7tat.pdb #1  
---  
Chain | Description | UniProt  
A | spike glycoprotein | SPIKE_SARS2  
B | spike glycoprotein | SPIKE_SARS2  
C | spike glycoprotein | SPIKE_SARS2  
D F H | S2K146 fab heavy chain |  
E | S2K146 fab light chain |  
G L | S2K146 fab light chain |  
  

> view

> open
> C:/Users/flbar/Dropbox/Casa_Trabalho/000_Paper_Abs/Structures_Modeller/Top5_6nb6.pdb

Summary of feedback from opening
C:/Users/flbar/Dropbox/Casa_Trabalho/000_Paper_Abs/Structures_Modeller/Top5_6nb6.pdb  
---  
warnings | Cannot find LINK/SSBOND residue CYS (19 )  
Cannot find LINK/SSBOND residue CYS (128 )  
Cannot find LINK/SSBOND residue CYS (278 )  
Cannot find LINK/SSBOND residue CYS (323 )  
Cannot find LINK/SSBOND residue CYS (366 )  
188 messages similar to the above omitted  
  
Top5_6nb6.pdb title:  
Sars-cov complex with human neutralizing S230 antibody fab fragment (state 1)
[more info...]  
  
Chain information for Top5_6nb6.pdb #2  
---  
Chain | Description  
H | S230 heavy chain  
I | S230 heavy chain  
L | S230 light chain  
M | S230 light chain  
  

> select #2/H:2-124

613 atoms, 616 bonds, 123 residues, 1 model selected  

> show sel surfaces

> select #2

2340 atoms, 2362 bonds, 466 residues, 1 model selected  

> show sel surfaces

> color #2 red transparency 0

> transparency (#!2 & sel) 40

> hide sel atoms

> hide sel cartoons

> select /D:1-120

591 atoms, 593 bonds, 120 residues, 1 model selected  

> show sel surfaces

> hide sel cartoons

> hide sel atoms

> color (#!1 & sel) lime

> select /F:1-120

591 atoms, 593 bonds, 120 residues, 1 model selected  

> hide sel cartoons

> hide sel atoms

> show sel surfaces

> color (#!1 & sel) lime

> transparency (#!1 & sel) 80

> select /H:1-120

1186 atoms, 1192 bonds, 239 residues, 2 models selected  

> show sel surfaces

> hide sel cartoons

> hide sel atoms

> color (#!1-2 & sel) lime

> transparency (#!1-2 & sel) 80

> select /H:1-120

1186 atoms, 1192 bonds, 239 residues, 2 models selected  

> show sel surfaces

> hide sel cartoons

> hide sel atoms

> color (#!1-2 & sel) lime

> transparency (#!1-2 & sel) 80

> select /E:3-108

533 atoms, 540 bonds, 106 residues, 1 model selected  

> show sel surfaces

> hide sel cartoons

> hide sel atoms

> color (#!1 & sel) lime

> select /G:1-108

543 atoms, 550 bonds, 108 residues, 1 model selected  

> show sel surfaces

> hide sel cartoons

> hide sel atoms

> color (#!1 & sel) lime

> transparency (#!1 & sel) 80

> select /L:1-108

1080 atoms, 1095 bonds, 214 residues, 2 models selected  

> show sel surfaces

> hide sel cartoons

> hide sel atoms

> color (#!1-2 & sel) lime

> transparency (#!1-2 & sel) 80

> color #2 red transparency 0

> open
> C:/Users/flbar/Dropbox/Casa_Trabalho/000_Paper_Abs/Structures_Modeller/Top5_7c2l.pdb

Summary of feedback from opening
C:/Users/flbar/Dropbox/Casa_Trabalho/000_Paper_Abs/Structures_Modeller/Top5_7c2l.pdb  
---  
warnings | Cannot find LINK/SSBOND residue CYS (15 )  
Cannot find LINK/SSBOND residue CYS (131 )  
Cannot find LINK/SSBOND residue CYS (291 )  
Cannot find LINK/SSBOND residue CYS (336 )  
Cannot find LINK/SSBOND residue CYS (379 )  
121 messages similar to the above omitted  
  
Top5_7c2l.pdb title:  
S protein of sars-cov-2 In complex bound with 4A8 [more info...]  
  
Chain information for Top5_7c2l.pdb #3  
---  
Chain | Description  
H I J | heavy chain of 4A8  
L M N | light chain of 4A8  
  

> select #3/H:1-229

1706 atoms, 1748 bonds, 229 residues, 1 model selected  

> show sel surfaces

> hide sel cartoons

> hide sel atoms

> color (#!3 & sel) orange

> select #3/L:1-219

1688 atoms, 1727 bonds, 219 residues, 1 model selected  

> show sel surfaces

> hide sel cartoons

> hide sel atoms

> color (#!3 & sel) orange

> select #3/I:1-229

1706 atoms, 1748 bonds, 229 residues, 1 model selected  

> hide sel surfaces

> hide sel cartoons

> hide sel atoms

> select #3/J:1-229

1706 atoms, 1748 bonds, 229 residues, 1 model selected  

> hide sel surfaces

> hide sel cartoons

> hide sel atoms

> select #3/M:1-219

1688 atoms, 1727 bonds, 219 residues, 1 model selected  

> hide sel surfaces

> hide sel cartoons

> hide sel atoms

> select #3/N:1-219

1688 atoms, 1727 bonds, 219 residues, 1 model selected  

> hide sel surfaces

> hide sel cartoons

> hide sel atoms

> open
> C:/Users/flbar/Dropbox/Casa_Trabalho/000_Paper_Abs/Structures_Modeller/Top5_P01primes.pdb.pdb

Summary of feedback from opening
C:/Users/flbar/Dropbox/Casa_Trabalho/000_Paper_Abs/Structures_Modeller/Top5_P01primes.pdb.pdb  
---  
warning | Cannot find LINK/SSBOND residue CYS (480 )  
  
Chain information for Top5_P01primes.pdb.pdb #4  
---  
Chain | Description  
A | No description available  
B | No description available  
C | No description available  
  

> select #4/A:1-148

1623 atoms, 1644 bonds, 115 residues, 1 model selected  

> show sel surfaces

> hide sel cartoons

> hide sel atoms

> surface (#!4 & sel)

> color (#!4 & sel) cyan

> transparency (#!4 & sel) 0

> select #4/B:1-148

1587 atoms, 1610 bonds, 118 residues, 1 model selected  

> show sel surfaces

> hide sel cartoons

> hide sel atoms

> color (#!4 & sel) cyan

> transparency (#!4 & sel) 0

> select #4/C:333-527

2821 atoms, 2869 bonds, 195 residues, 1 model selected  

> show sel surfaces

> hide sel cartoons

> hide sel atoms

> color (#!4 & sel) cyan

> transparency (#!4 & sel) 0

> select /A:26-1140

8252 atoms, 8444 bonds, 11 pseudobonds, 1070 residues, 3 models selected  

> color (#!1,4 & sel) dim gray

> select /B:27-1140

7770 atoms, 7946 bonds, 12 pseudobonds, 1049 residues, 3 models selected  

> color (#!1,4 & sel) dark gray

> select /C:27-1141

9132 atoms, 9315 bonds, 13 pseudobonds, 1141 residues, 3 models selected  

> color (#!1,4 & sel) gray

> select clear

> open
> C:/Users/flbar/Dropbox/Casa_Trabalho/000_Paper_Abs/Structures_Modeller/Top5_7c01.pdb

Summary of feedback from opening
C:/Users/flbar/Dropbox/Casa_Trabalho/000_Paper_Abs/Structures_Modeller/Top5_7c01.pdb  
---  
warnings | Cannot find LINK/SSBOND residue CYS (336 )  
Cannot find LINK/SSBOND residue CYS (379 )  
Cannot find LINK/SSBOND residue CYS (391 )  
Cannot find LINK/SSBOND residue CYS (480 )  
Cannot find LINK/SSBOND residue CYS (336 )  
5 messages similar to the above omitted  
  
Top5_7c01.pdb title:  
Molecular basis for A potent human neutralizing antibody targeting sars-cov-2
RBD [more info...]  
  
Chain information for Top5_7c01.pdb #5  
---  
Chain | Description  
C H | CB6 heavy chain  
D L | CB6 light chain  
  

> color #5 #0055ff transparency 0

> show surfaces

> hide cartoons

> hide atoms

> view

> select #1/A

6961 atoms, 7134 bonds, 11 pseudobonds, 980 residues, 2 models selected  

> color (#!1 & sel) gray

> select #1/B

6518 atoms, 6672 bonds, 12 pseudobonds, 956 residues, 2 models selected  

> color (#!1 & sel) dark gray

> select #1/C

6311 atoms, 6446 bonds, 13 pseudobonds, 946 residues, 2 models selected  

> color (#!1 & sel) dim gray

> select clear

> select #4/A

1623 atoms, 1644 bonds, 115 residues, 1 model selected  

> select #2/H#2/I

1231 atoms, 1237 bonds, 247 residues, 1 model selected  

> color (#!2 & sel) red

> select #2/L#2/M

1109 atoms, 1125 bonds, 219 residues, 1 model selected  

> color (#!2 & sel) red

> select #1/D

591 atoms, 593 bonds, 120 residues, 1 model selected  

> color (#!1 & sel) lime

> select #1/D#1/F#1/H

1775 atoms, 1782 bonds, 360 residues, 1 model selected  

> color (#!1 & sel) lime

> select #1/E#1/G#1/L

1619 atoms, 1640 bonds, 322 residues, 1 model selected  

> color (#!1 & sel) lime

> select #3/H#3/I#3/J

5118 atoms, 5244 bonds, 687 residues, 1 model selected  

> color (#!3 & sel) orange

> select #3/L#3/M#3/N

5064 atoms, 5181 bonds, 657 residues, 1 model selected  

> color (#!3 & sel) orange

> select #3/L

1688 atoms, 1727 bonds, 219 residues, 1 model selected  

> select #3/H

1706 atoms, 1748 bonds, 229 residues, 1 model selected  

> surface hidePatches (#!3 & sel)

> select #3/I

1706 atoms, 1748 bonds, 229 residues, 1 model selected  

> select #3/J

1706 atoms, 1748 bonds, 229 residues, 1 model selected  

> surface hidePatches (#!3 & sel)

> select #3/H

1706 atoms, 1748 bonds, 229 residues, 1 model selected  

> select #3/L

1688 atoms, 1727 bonds, 219 residues, 1 model selected  

> view sel


===== Log before crash end =====

Log:
UCSF ChimeraX version: 1.3 (2021-12-08)  
© 2016-2021 Regents of the University of California. All rights reserved.  
How to cite UCSF ChimeraX  




OpenGL version: 3.3.0 NVIDIA 376.54
OpenGL renderer: GeForce GT 630M/PCIe/SSE2
OpenGL vendor: NVIDIA Corporation
Manufacturer: SAMSUNG ELECTRONICS CO., LTD.
Model: 550P5C/550P7C
OS: Microsoft Windows 10 Home Single Language (Build 19044)
Memory: 8,471,752,704
MaxProcessMemory: 137,438,953,344
CPU: 8 Intel(R) Core(TM) i7-3630QM CPU @ 2.40GHz
OSLanguage: pt-BR
Locale: ('pt_BR', 'cp1252')
PyQt5 5.15.2, Qt 5.15.2
Installed Packages:
    alabaster: 0.7.12
    appdirs: 1.4.4
    Babel: 2.9.1
    backcall: 0.2.0
    blockdiag: 2.0.1
    certifi: 2021.10.8
    cftime: 1.5.1.1
    charset-normalizer: 2.0.9
    ChimeraX-AddCharge: 1.2.2
    ChimeraX-AddH: 2.1.11
    ChimeraX-AlignmentAlgorithms: 2.0
    ChimeraX-AlignmentHdrs: 3.2
    ChimeraX-AlignmentMatrices: 2.0
    ChimeraX-Alignments: 2.2.3
    ChimeraX-AlphaFold: 1.0
    ChimeraX-AltlocExplorer: 1.0.1
    ChimeraX-AmberInfo: 1.0
    ChimeraX-Arrays: 1.0
    ChimeraX-Atomic: 1.31
    ChimeraX-AtomicLibrary: 4.2
    ChimeraX-AtomSearch: 2.0
    ChimeraX-AtomSearchLibrary: 1.0
    ChimeraX-AxesPlanes: 2.0
    ChimeraX-BasicActions: 1.1
    ChimeraX-BILD: 1.0
    ChimeraX-BlastProtein: 2.0
    ChimeraX-BondRot: 2.0
    ChimeraX-BugReporter: 1.0
    ChimeraX-BuildStructure: 2.6.1
    ChimeraX-Bumps: 1.0
    ChimeraX-BundleBuilder: 1.1
    ChimeraX-ButtonPanel: 1.0
    ChimeraX-CageBuilder: 1.0
    ChimeraX-CellPack: 1.0
    ChimeraX-Centroids: 1.2
    ChimeraX-ChemGroup: 2.0
    ChimeraX-Clashes: 2.2.2
    ChimeraX-ColorActions: 1.0
    ChimeraX-ColorGlobe: 1.0
    ChimeraX-ColorKey: 1.5
    ChimeraX-CommandLine: 1.1.5
    ChimeraX-ConnectStructure: 2.0
    ChimeraX-Contacts: 1.0
    ChimeraX-Core: 1.3
    ChimeraX-CoreFormats: 1.1
    ChimeraX-coulombic: 1.3.2
    ChimeraX-Crosslinks: 1.0
    ChimeraX-Crystal: 1.0
    ChimeraX-CrystalContacts: 1.0
    ChimeraX-DataFormats: 1.2.2
    ChimeraX-Dicom: 1.0
    ChimeraX-DistMonitor: 1.1.5
    ChimeraX-DistUI: 1.0
    ChimeraX-Dssp: 2.0
    ChimeraX-EMDB-SFF: 1.0
    ChimeraX-ExperimentalCommands: 1.0
    ChimeraX-FileHistory: 1.0
    ChimeraX-FunctionKey: 1.0
    ChimeraX-Geometry: 1.1
    ChimeraX-gltf: 1.0
    ChimeraX-Graphics: 1.1
    ChimeraX-Hbonds: 2.1.2
    ChimeraX-Help: 1.2
    ChimeraX-HKCage: 1.3
    ChimeraX-IHM: 1.1
    ChimeraX-ImageFormats: 1.2
    ChimeraX-IMOD: 1.0
    ChimeraX-IO: 1.0.1
    ChimeraX-ItemsInspection: 1.0
    ChimeraX-Label: 1.1
    ChimeraX-ListInfo: 1.1.1
    ChimeraX-Log: 1.1.4
    ChimeraX-LookingGlass: 1.1
    ChimeraX-Maestro: 1.8.1
    ChimeraX-Map: 1.1
    ChimeraX-MapData: 2.0
    ChimeraX-MapEraser: 1.0
    ChimeraX-MapFilter: 2.0
    ChimeraX-MapFit: 2.0
    ChimeraX-MapSeries: 2.1
    ChimeraX-Markers: 1.0
    ChimeraX-Mask: 1.0
    ChimeraX-MatchMaker: 2.0.4
    ChimeraX-MDcrds: 2.6
    ChimeraX-MedicalToolbar: 1.0.1
    ChimeraX-Meeting: 1.0
    ChimeraX-MLP: 1.1
    ChimeraX-mmCIF: 2.4
    ChimeraX-MMTF: 2.1
    ChimeraX-Modeller: 1.2.6
    ChimeraX-ModelPanel: 1.2.1
    ChimeraX-ModelSeries: 1.0
    ChimeraX-Mol2: 2.0
    ChimeraX-Morph: 1.0
    ChimeraX-MouseModes: 1.1
    ChimeraX-Movie: 1.0
    ChimeraX-Neuron: 1.0
    ChimeraX-Nucleotides: 2.0.2
    ChimeraX-OpenCommand: 1.7
    ChimeraX-PDB: 2.6.5
    ChimeraX-PDBBio: 1.0
    ChimeraX-PDBLibrary: 1.0.2
    ChimeraX-PDBMatrices: 1.0
    ChimeraX-PickBlobs: 1.0
    ChimeraX-Positions: 1.0
    ChimeraX-PresetMgr: 1.0.1
    ChimeraX-PubChem: 2.1
    ChimeraX-ReadPbonds: 1.0.1
    ChimeraX-Registration: 1.1
    ChimeraX-RemoteControl: 1.0
    ChimeraX-ResidueFit: 1.0
    ChimeraX-RestServer: 1.1
    ChimeraX-RNALayout: 1.0
    ChimeraX-RotamerLibMgr: 2.0.1
    ChimeraX-RotamerLibsDunbrack: 2.0
    ChimeraX-RotamerLibsDynameomics: 2.0
    ChimeraX-RotamerLibsRichardson: 2.0
    ChimeraX-SaveCommand: 1.5
    ChimeraX-SchemeMgr: 1.0
    ChimeraX-SDF: 2.0
    ChimeraX-Segger: 1.0
    ChimeraX-Segment: 1.0
    ChimeraX-SelInspector: 1.0
    ChimeraX-SeqView: 2.4.6
    ChimeraX-Shape: 1.0.1
    ChimeraX-Shell: 1.0
    ChimeraX-Shortcuts: 1.1
    ChimeraX-ShowAttr: 1.0
    ChimeraX-ShowSequences: 1.0
    ChimeraX-SideView: 1.0
    ChimeraX-Smiles: 2.1
    ChimeraX-SmoothLines: 1.0
    ChimeraX-SpaceNavigator: 1.0
    ChimeraX-StdCommands: 1.6.1
    ChimeraX-STL: 1.0
    ChimeraX-Storm: 1.0
    ChimeraX-Struts: 1.0
    ChimeraX-Surface: 1.0
    ChimeraX-SwapAA: 2.0
    ChimeraX-SwapRes: 2.1
    ChimeraX-TapeMeasure: 1.0
    ChimeraX-Test: 1.0
    ChimeraX-Toolbar: 1.1
    ChimeraX-ToolshedUtils: 1.2
    ChimeraX-Tug: 1.0
    ChimeraX-UI: 1.13.7
    ChimeraX-uniprot: 2.2
    ChimeraX-UnitCell: 1.0
    ChimeraX-ViewDockX: 1.0.1
    ChimeraX-VIPERdb: 1.0
    ChimeraX-Vive: 1.1
    ChimeraX-VolumeMenu: 1.0
    ChimeraX-VTK: 1.0
    ChimeraX-WavefrontOBJ: 1.0
    ChimeraX-WebCam: 1.0
    ChimeraX-WebServices: 1.0
    ChimeraX-Zone: 1.0
    colorama: 0.4.4
    comtypes: 1.1.10
    cxservices: 1.1
    cycler: 0.11.0
    Cython: 0.29.24
    decorator: 5.1.0
    docutils: 0.17.1
    filelock: 3.0.12
    funcparserlib: 0.3.6
    grako: 3.16.5
    h5py: 3.6.0
    html2text: 2020.1.16
    idna: 3.3
    ihm: 0.21
    imagecodecs: 2021.4.28
    imagesize: 1.3.0
    ipykernel: 5.5.5
    ipython: 7.23.1
    ipython-genutils: 0.2.0
    jedi: 0.18.0
    Jinja2: 3.0.1
    jupyter-client: 6.1.12
    jupyter-core: 4.9.1
    kiwisolver: 1.3.2
    lxml: 4.6.3
    lz4: 3.1.3
    MarkupSafe: 2.0.1
    matplotlib: 3.4.3
    matplotlib-inline: 0.1.3
    msgpack: 1.0.2
    netCDF4: 1.5.7
    networkx: 2.6.3
    numexpr: 2.8.0
    numpy: 1.21.2
    openvr: 1.16.801
    packaging: 21.3
    ParmEd: 3.2.0
    parso: 0.8.3
    pickleshare: 0.7.5
    Pillow: 8.3.2
    pip: 21.2.4
    pkginfo: 1.7.1
    prompt-toolkit: 3.0.23
    psutil: 5.8.0
    pycollada: 0.7.1
    pydicom: 2.1.2
    Pygments: 2.10.0
    PyOpenGL: 3.1.5
    PyOpenGL-accelerate: 3.1.5
    pyparsing: 3.0.6
    PyQt5-commercial: 5.15.2
    PyQt5-sip: 12.8.1
    PyQtWebEngine-commercial: 5.15.2
    python-dateutil: 2.8.2
    pytz: 2021.3
    pywin32: 228
    pyzmq: 22.3.0
    qtconsole: 5.1.1
    QtPy: 1.11.3
    RandomWords: 0.3.0
    requests: 2.26.0
    scipy: 1.7.1
    setuptools: 57.5.0
    sfftk-rw: 0.7.1
    six: 1.16.0
    snowballstemmer: 2.2.0
    sortedcontainers: 2.4.0
    Sphinx: 4.2.0
    sphinx-autodoc-typehints: 1.12.0
    sphinxcontrib-applehelp: 1.0.2
    sphinxcontrib-blockdiag: 2.0.0
    sphinxcontrib-devhelp: 1.0.2
    sphinxcontrib-htmlhelp: 2.0.0
    sphinxcontrib-jsmath: 1.0.1
    sphinxcontrib-qthelp: 1.0.3
    sphinxcontrib-serializinghtml: 1.1.5
    suds-jurko: 0.6
    tables: 3.6.1
    tifffile: 2021.4.8
    tinyarray: 1.2.3
    tornado: 6.1
    traitlets: 5.1.1
    urllib3: 1.26.7
    wcwidth: 0.2.5
    webcolors: 1.11.1
    wheel: 0.37.0
    wheel-filename: 1.3.0
    WMI: 1.5.1

Change History (2)

comment:1 by Tom Goddard, 5 years ago

Cc: Eric Pettersen added
Component: UnassignedWindow Toolkit
Owner: set to Tom Goddard
Platform: all
Project: ChimeraX
Status: newassigned
Summary: ChimeraX bug report submissionCrash in Qt event loop after "view sel" command, 10 year old graphics, Windows

comment:2 by Tom Goddard, 5 years ago

Resolution: can't reproduce
Status: assignedclosed

Maybe a graphics driver crash. Log was hundreds of commands long. No clues.

Note: See TracTickets for help on using tickets.