Opened 5 years ago
Last modified 4 years ago
#6140 assigned defect
Crash drawing side view during alphafold prediction
| Reported by: | Owned by: | Greg Couch | |
|---|---|---|---|
| Priority: | normal | Milestone: | |
| Component: | Graphics | Version: | |
| Keywords: | Cc: | Tom Goddard | |
| Blocked By: | Blocking: | ||
| Notify when closed: | Platform: | all | |
| Project: | ChimeraX |
Description
The following bug report has been submitted:
Platform: Windows-10-10.0.19043
ChimeraX Version: 1.4.dev202202090150 (2022-02-09 01:50:51 UTC)
Description
Last time you used ChimeraX it crashed.
Please describe steps that led to the crash here.
Windows fatal exception: code 0x8001010d
Current thread 0x000044c4 (most recent call first):
File "C:\Program Files\ChimeraX 1.4.dev202202090150\bin\lib\site-packages\chimerax\ui\gui.py", line 318 in event_loop
File "C:\Program Files\ChimeraX 1.4.dev202202090150\bin\lib\site-packages\ChimeraX_main.py", line 867 in init
File "C:\Program Files\ChimeraX 1.4.dev202202090150\bin\lib\site-packages\ChimeraX_main.py", line 1018 in
File "C:\Program Files\ChimeraX 1.4.dev202202090150\bin\lib\runpy.py", line 87 in _run_code
File "C:\Program Files\ChimeraX 1.4.dev202202090150\bin\lib\runpy.py", line 197 in _run_module_as_main
Windows fatal exception: access violation
Current thread 0x000044c4 (most recent call first):
File "C:\Program Files\ChimeraX 1.4.dev202202090150\bin\lib\site-packages\chimerax\graphics\opengl.py", line 111 in make_current
File "C:\Program Files\ChimeraX 1.4.dev202202090150\bin\lib\site-packages\chimerax\graphics\opengl.py", line 490 in make_current
File "C:\Program Files\ChimeraX 1.4.dev202202090150\bin\lib\site-packages\chimerax\graphics\opengl.py", line 536 in use_shared_context
File "C:\Program Files\ChimeraX 1.4.dev202202090150\bin\lib\site-packages\chimerax\sideview\tool.py", line 282 in render
File "C:\Program Files\ChimeraX 1.4.dev202202090150\bin\lib\site-packages\chimerax\sideview\tool.py", line 116 in exposeEvent
File "C:\Program Files\ChimeraX 1.4.dev202202090150\bin\lib\site-packages\chimerax\ui\gui.py", line 318 in event_loop
File "C:\Program Files\ChimeraX 1.4.dev202202090150\bin\lib\site-packages\ChimeraX_main.py", line 867 in init
File "C:\Program Files\ChimeraX 1.4.dev202202090150\bin\lib\site-packages\ChimeraX_main.py", line 1018 in
File "C:\Program Files\ChimeraX 1.4.dev202202090150\bin\lib\runpy.py", line 87 in _run_code
File "C:\Program Files\ChimeraX 1.4.dev202202090150\bin\lib\runpy.py", line 197 in _run_module_as_main
===== Log before crash start =====
UCSF ChimeraX version: 1.4.dev202202090150 (2022-02-09)
© 2016-2021 Regents of the University of California. All rights reserved.
How to cite UCSF ChimeraX
> ui tool show AlphaFold
> alphafold predict
> IRGLSGGQKVKLVLAAGTWQRPHLIVLDEPTNYLDRDSLGALSKALKEFEGGVIIITHSAEFTKNLTEEVWAVKDGRMTPSGHNWVSGQGAGPRIEKKEDEEDKFDAMGNKIAGGKKKKKLSSAELRKKKKERMKKKKELGDAYVSSDEEF
Running AlphaFold prediction
AlphaFold prediction finished
Results in C:\Users\mniak/Downloads\ChimeraX\AlphaFold\prediction_1
Chain information for best_model.pdb #1
---
Chain | Description
A | No description available
> select #1
2393 atoms, 2411 bonds, 151 residues, 1 model selected
> ~select #1
Nothing selected
> hide #1 models
> show #1 models
> alphafold predict
> IRGLSGGQKVKLVLAAGTWQRPHLIVLDEPTNYLDRDSLGALSKALKEFEGGVIIITHSAEFTKNLTEEVWAVKDGRMTPSGHNWVSGQGAGPRIEKKEDEEDKFDAMGNKIAGGKKKKKLSSAELRKKKKERMKKKKELGDAYVEEDEEF
Running AlphaFold prediction
> select #1
2393 atoms, 2411 bonds, 151 residues, 1 model selected
> ~select #1
Nothing selected
> ui mousemode right swapaa
> swapaa mousemode /A:139 GLU
> undo
Undo failed, probably because structures have been modified.
> ui mousemode right swapaa
> swapaa mousemode /A:146 MET
> swapaa mousemode /A:146 LYS
> swapaa mousemode /A:146 ALA
> ui mousemode right swapaa
> swapaa mousemode /A:146 ALA
> ui mousemode right "bond rotation"
> ui mousemode right swapaa
> swapaa mousemode /A:139 GLY
> swapaa mousemode /A:146 ALA
> swapaa mousemode /A:146 VAL
> swapaa mousemode /A:146 ALA
> swapaa mousemode /A:146 ARG
> swapaa mousemode /A:146 ASP
> swapaa mousemode /A:146 GLY
> ui mousemode right swapaa
> swapaa mousemode /A:146 GLY
> select #1
2381 atoms, 2399 bonds, 151 residues, 1 model selected
> ~select #1
Nothing selected
> view clip false
> show target m
> hide target m
> show target m
> style stick
Changed 2381 atom styles
> style stick
Changed 2381 atom styles
> ui tool show "Side View"
> graphics silhouettes true
> graphics silhouettes false
> color bychain
> ui mousemode right "contour level"
> volume style surface
No volumes specified
> volume style surface
No volumes specified
> color byhetero
> coulombic
Using Amber 20 recommended default charges and atom types for standard
residues
Coulombic values for best_model.pdb_A SES surface #1.1: minimum, -12.68, mean
1.59, maximum 14.41
To also show corresponding color key, enter the above coulombic command and
add key true
> mlp
Map values for surface "best_model.pdb_A SES surface": minimum -29.45, mean
-3.129, maximum 23.36
To also show corresponding color key, enter the above mlp command and add key
true
> coulombic
Coulombic values for best_model.pdb_A SES surface #1.1: minimum, -12.68, mean
1.59, maximum 14.41
To also show corresponding color key, enter the above coulombic command and
add key true
> color byhetero
> color bychain
> style stick
Changed 2381 atom styles
> rainbow
> color bychain
> show cartoons
> cartoon
> style stick
Changed 2381 atom styles
> hide surfaces
> coulombic
Coulombic values for best_model.pdb_A SES surface #1.1: minimum, -12.68, mean
1.59, maximum 14.41
To also show corresponding color key, enter the above coulombic command and
add key true
> coulombic
Coulombic values for best_model.pdb_A SES surface #1.1: minimum, -12.68, mean
1.59, maximum 14.41
To also show corresponding color key, enter the above coulombic command and
add key true
> hide surfaces
> mlp
Map values for surface "best_model.pdb_A SES surface": minimum -29.45, mean
-3.129, maximum 23.36
To also show corresponding color key, enter the above mlp command and add key
true
> hide surfaces
> show atoms
> hide atoms
> color bfactor
2381 atoms, 151 residues, 1 surfaces, atom bfactor range 33.1 to 96.2
Alignment identifier is 1/A
> select /A:139,146
14 atoms, 12 bonds, 2 residues, 1 model selected
> hbonds sel reveal true
2 hydrogen bonds found
> hbonds sel reveal true
2 hydrogen bonds found
> ~hbonds
> hbonds sel reveal true
2 hydrogen bonds found
> ~hbonds
> interfaces select & ~solvent
Missing or invalid "atoms" argument: invalid atoms specifier
> select #1
2381 atoms, 2399 bonds, 151 residues, 1 model selected
> ~select #1
1 model selected
> select #1
2381 atoms, 2399 bonds, 151 residues, 1 model selected
> ~select #1
1 model selected
> show #!1 target m
> style stick
Changed 2381 atom styles
> style ball
Changed 2381 atom styles
Alignment identifier is 1/A
> select /A:115-116
29 atoms, 28 bonds, 2 residues, 1 model selected
> select /A:115-119
95 atoms, 94 bonds, 5 residues, 1 model selected
> select /A:116
22 atoms, 21 bonds, 1 residue, 1 model selected
> select /A:116-120
110 atoms, 109 bonds, 5 residues, 1 model selected
> select /A:99
15 atoms, 14 bonds, 1 residue, 1 model selected
> select /A:99-103
69 atoms, 68 bonds, 5 residues, 1 model selected
> hide #!1 target m
> show #!1 models
> select /A:6-18,36-48,60-63,85-88,123-143
870 atoms, 868 bonds, 55 residues, 1 model selected
> select #1
2381 atoms, 2399 bonds, 151 residues, 1 model selected
> ~select #1
1 model selected
> select /A:127
24 atoms, 23 bonds, 1 residue, 1 model selected
> select /A:127-131
112 atoms, 111 bonds, 5 residues, 1 model selected
> select /A:120-121
41 atoms, 40 bonds, 2 residues, 1 model selected
> select /A:116-121
129 atoms, 128 bonds, 6 residues, 1 model selected
> open https://www.rbvi.ucsf.edu/chimerax/tutorials.html
Opened https://www.rbvi.ucsf.edu/chimerax/tutorials.html
QMainWindowLayout::tabPosition called with out-of-bounds value '0'
> open https://www.rbvi.ucsf.edu/chimerax/tutorials.html
Opened https://www.rbvi.ucsf.edu/chimerax/tutorials.html
> ui mousemode right "next docked"
AlphaFold prediction finished
Results in C:\Users\mniak/Downloads\ChimeraX\AlphaFold\prediction_2
Chain information for best_model.pdb #2
---
Chain | Description
A | No description available
> hide #!1 models
Destroying pre-existing alignment with identifier 1/A
Alignment identifier is 1/A
> show #!1 models
> hide #!1 models
> show #!1 models
> hide #!1 models
> show #!1 models
> open https://www.rbvi.ucsf.edu/chimerax/tutorials.html
Opened https://www.rbvi.ucsf.edu/chimerax/tutorials.html
Destroying pre-existing alignment with identifier 1/A
Alignment identifier is 1/A
Destroying pre-existing alignment with identifier 1/A
Alignment identifier is 1/A
> select #2
2401 atoms, 2419 bonds, 151 residues, 1 model selected
> select #1
2381 atoms, 2399 bonds, 151 residues, 1 model selected
> select #2
2401 atoms, 2419 bonds, 151 residues, 1 model selected
Alignment identifier is 2/A
> select #1
2381 atoms, 2399 bonds, 151 residues, 1 model selected
> color #1 red transparency 0
> color #2 #55007f transparency 0
> mmaker #2 to #1 showAlignment true
Parameters
---
Chain pairing | bb
Alignment algorithm | Needleman-Wunsch
Similarity matrix | BLOSUM-62
SS fraction | 0.3
Gap open (HH/SS/other) | 18/18/6
Gap extend | 1
SS matrix | | | H | S | O
---|---|---|---
H | 6 | -9 | -6
S | | 6 | -6
O | | | 4
Iteration cutoff | 2
Matchmaker best_model.pdb, chain A (#1) with best_model.pdb, chain A (#2),
sequence alignment score = 744.8
Alignment identifier is 1
Showing conservation header ("seq_conservation" residue attribute) for
alignment 1
Hiding conservation header for alignment 1
Chains used in RMSD evaluation for alignment 1: best_model.pdb #1/A,
best_model.pdb #2/A
Showing rmsd header ("seq_rmsd" residue attribute) for alignment 1
RMSD between 41 pruned atom pairs is 0.933 angstroms; (across all 151 pairs:
6.766)
> alphafold predict
> MPREDRATWKSNYFLKIIQLLDDYPKCFIVGADNVGSKQMQQIRMSLRGKAVVLMGKNTMMRKAIRGHLENNPALEKLLPHIRGNVGFVFTKEDLTEIRDMLLANKVPAAARAGAIAPCEVTVPAQNTGLGPEKTSFFQALGITTKISRGTIEILSDVQLIKTGDKVGASEATLLNMLNISPFSFGLVIQQVFDNGSIYNPEVLDITEETLHSRFLEGVRNVASVCLQIGYPTVASVPHSIINGYKRVLALSVETDYTFPLAEKVKAFLADPSAFVAAAPVAAATTAAPAAAAAPAKVEAKEESEESDEDMGFGLFD,MASVSELACIYSALILHDDEVTVTEDKINALIKAAGVNVEPFWPGLFAKALANVNIGSLICNVGAGGPAPAAGAAPAGGPAPSTAAAPAEEKKVEAKKEESEESDDDMGFGLFD,MASVSELACIYSALILHDDEVTVTEDKINALIKAAGVNVEPFWPGLFAKALANVNIGSLICNVGAGGPAPAAGAAPAGGPAPSTAAAPAEEKKVEAKKEESEESDDDMGFGLFD,MRYVASYLLAALGGNSSPSAKDIKKILDSVGIEADDDRLNKVISELNGKNIEDVIAQGIGKLASVPAGGAVAVSAAPGSAAPAAGSAPAAAEEKKDEKKEESEESDDDMGFGLFD,MRYVASYLLAALGGNSSPSAKDIKKILDSVGIEADDDRLNKVISELNGKNIEDVIAQGIGKLASVPAGGAVAVSAAPGSAAPAAGSAPAAAEEKKDEKKEESEESDDDMGFGLFD
Running AlphaFold prediction
> open
> C:/Users/mniak/Downloads/ChimeraX/AlphaFold/prediction_2/model_1_unrelaxed.pdb
Chain information for model_1_unrelaxed.pdb #3
---
Chain | Description
A | No description available
Associated model_1_unrelaxed.pdb chain A to best_model.pdb, chain A with 0
mismatches
Chains used in RMSD evaluation for alignment 1: best_model.pdb #1/A,
best_model.pdb #2/A, model_1_unrelaxed.pdb #3/A
> hide #3 models
> open
> C:/Users/mniak/Downloads/ChimeraX/AlphaFold/prediction_2/model_2_unrelaxed.pdb
Chain information for model_2_unrelaxed.pdb #4
---
Chain | Description
A | No description available
Associated model_2_unrelaxed.pdb chain A to best_model.pdb, chain A with 0
mismatches
Chains used in RMSD evaluation for alignment 1: best_model.pdb #1/A,
best_model.pdb #2/A, model_1_unrelaxed.pdb #3/A, model_2_unrelaxed.pdb #4/A
> hide #4 models
> open
> C:/Users/mniak/Downloads/ChimeraX/AlphaFold/prediction_2/model_3_unrelaxed.pdb
Chain information for model_3_unrelaxed.pdb #5
---
Chain | Description
A | No description available
Associated model_3_unrelaxed.pdb chain A to best_model.pdb, chain A with 0
mismatches
Chains used in RMSD evaluation for alignment 1: best_model.pdb #1/A,
best_model.pdb #2/A, model_1_unrelaxed.pdb #3/A, model_2_unrelaxed.pdb #4/A,
model_3_unrelaxed.pdb #5/A
> hide #2 models
> mmaker #5 to #1 showAlignment true
Parameters
---
Chain pairing | bb
Alignment algorithm | Needleman-Wunsch
Similarity matrix | BLOSUM-62
SS fraction | 0.3
Gap open (HH/SS/other) | 18/18/6
Gap extend | 1
SS matrix | | | H | S | O
---|---|---|---
H | 6 | -9 | -6
S | | 6 | -6
O | | | 4
Iteration cutoff | 2
Matchmaker best_model.pdb, chain A (#1) with model_3_unrelaxed.pdb, chain A
(#5), sequence alignment score = 726.8
Alignment identifier is 2
Showing conservation header ("seq_conservation" residue attribute) for
alignment 2
Hiding conservation header for alignment 2
Chains used in RMSD evaluation for alignment 2: best_model.pdb #1/A,
model_3_unrelaxed.pdb #5/A
Showing rmsd header ("seq_rmsd" residue attribute) for alignment 2
RMSD between 80 pruned atom pairs is 0.422 angstroms; (across all 151 pairs:
7.443)
> open
> C:/Users/mniak/Downloads/ChimeraX/AlphaFold/prediction_2/model_4_unrelaxed.pdb
Chain information for model_4_unrelaxed.pdb #6
---
Chain | Description
A | No description available
Associated model_4_unrelaxed.pdb chain A to best_model.pdb, chain A with 0
mismatches
Chains used in RMSD evaluation for alignment 1: best_model.pdb #1/A,
best_model.pdb #2/A, model_1_unrelaxed.pdb #3/A, model_2_unrelaxed.pdb #4/A,
model_3_unrelaxed.pdb #5/A, model_4_unrelaxed.pdb #6/A
Associated model_4_unrelaxed.pdb chain A to model_3_unrelaxed.pdb, chain A
with 0 mismatches
Chains used in RMSD evaluation for alignment 2: best_model.pdb #1/A,
model_3_unrelaxed.pdb #5/A, model_4_unrelaxed.pdb #6/A
> hide #6 models
> open
> C:/Users/mniak/Downloads/ChimeraX/AlphaFold/prediction_2/model_5_unrelaxed.pdb
Chain information for model_5_unrelaxed.pdb #7
---
Chain | Description
A | No description available
Associated model_5_unrelaxed.pdb chain A to best_model.pdb, chain A with 0
mismatches
Chains used in RMSD evaluation for alignment 1: best_model.pdb #1/A,
best_model.pdb #2/A, model_1_unrelaxed.pdb #3/A, model_2_unrelaxed.pdb #4/A,
model_3_unrelaxed.pdb #5/A, model_4_unrelaxed.pdb #6/A, model_5_unrelaxed.pdb
#7/A
Associated model_5_unrelaxed.pdb chain A to model_3_unrelaxed.pdb, chain A
with 0 mismatches
Chains used in RMSD evaluation for alignment 2: best_model.pdb #1/A,
model_3_unrelaxed.pdb #5/A, model_4_unrelaxed.pdb #6/A, model_5_unrelaxed.pdb
#7/A
> hide #7 models
> open
> C:/Users/mniak/Downloads/ChimeraX/AlphaFold/prediction_1/model_1_unrelaxed.pdb
Chain information for model_1_unrelaxed.pdb #8
---
Chain | Description
A | No description available
Associated model_1_unrelaxed.pdb chain A to best_model.pdb, chain A with 0
mismatches
Chains used in RMSD evaluation for alignment 1: best_model.pdb #1/A,
best_model.pdb #2/A, model_1_unrelaxed.pdb #3/A, model_2_unrelaxed.pdb #4/A,
model_3_unrelaxed.pdb #5/A, model_4_unrelaxed.pdb #6/A, model_5_unrelaxed.pdb
#7/A, model_1_unrelaxed.pdb #8/A
Associated model_1_unrelaxed.pdb chain A to best_model.pdb, chain A with 0
mismatches
Chains used in RMSD evaluation for alignment 2: best_model.pdb #1/A,
model_3_unrelaxed.pdb #5/A, model_4_unrelaxed.pdb #6/A, model_5_unrelaxed.pdb
#7/A, model_1_unrelaxed.pdb #8/A
> hide #8 models
> open
> C:/Users/mniak/Downloads/ChimeraX/AlphaFold/prediction_1/model_2_unrelaxed.pdb
Chain information for model_2_unrelaxed.pdb #9
---
Chain | Description
A | No description available
Associated model_2_unrelaxed.pdb chain A to best_model.pdb, chain A with 0
mismatches
Chains used in RMSD evaluation for alignment 1: best_model.pdb #1/A,
best_model.pdb #2/A, model_1_unrelaxed.pdb #3/A, model_2_unrelaxed.pdb #4/A,
model_3_unrelaxed.pdb #5/A, model_4_unrelaxed.pdb #6/A, model_5_unrelaxed.pdb
#7/A, model_1_unrelaxed.pdb #8/A, model_2_unrelaxed.pdb #9/A
Associated model_2_unrelaxed.pdb chain A to best_model.pdb, chain A with 0
mismatches
Chains used in RMSD evaluation for alignment 2: best_model.pdb #1/A,
model_3_unrelaxed.pdb #5/A, model_4_unrelaxed.pdb #6/A, model_5_unrelaxed.pdb
#7/A, model_1_unrelaxed.pdb #8/A, model_2_unrelaxed.pdb #9/A
> hide #9 models
> open
> C:/Users/mniak/Downloads/ChimeraX/AlphaFold/prediction_1/model_3_unrelaxed.pdb
Chain information for model_3_unrelaxed.pdb #10
---
Chain | Description
A | No description available
Associated model_3_unrelaxed.pdb chain A to best_model.pdb, chain A with 0
mismatches
Chains used in RMSD evaluation for alignment 1: best_model.pdb #1/A,
best_model.pdb #2/A, model_1_unrelaxed.pdb #3/A, model_2_unrelaxed.pdb #4/A,
model_3_unrelaxed.pdb #5/A, model_4_unrelaxed.pdb #6/A, model_5_unrelaxed.pdb
#7/A, model_1_unrelaxed.pdb #8/A, model_2_unrelaxed.pdb #9/A,
model_3_unrelaxed.pdb #10/A
Associated model_3_unrelaxed.pdb chain A to best_model.pdb, chain A with 0
mismatches
Chains used in RMSD evaluation for alignment 2: best_model.pdb #1/A,
model_3_unrelaxed.pdb #5/A, model_4_unrelaxed.pdb #6/A, model_5_unrelaxed.pdb
#7/A, model_1_unrelaxed.pdb #8/A, model_2_unrelaxed.pdb #9/A,
model_3_unrelaxed.pdb #10/A
> hide #10 models
> open
> C:/Users/mniak/Downloads/ChimeraX/AlphaFold/prediction_1/model_4_unrelaxed.pdb
Chain information for model_4_unrelaxed.pdb #11
---
Chain | Description
A | No description available
Associated model_4_unrelaxed.pdb chain A to best_model.pdb, chain A with 0
mismatches
Chains used in RMSD evaluation for alignment 1: best_model.pdb #1/A,
best_model.pdb #2/A, model_1_unrelaxed.pdb #3/A, model_2_unrelaxed.pdb #4/A,
model_3_unrelaxed.pdb #5/A, model_4_unrelaxed.pdb #6/A, model_5_unrelaxed.pdb
#7/A, model_1_unrelaxed.pdb #8/A, model_2_unrelaxed.pdb #9/A,
model_3_unrelaxed.pdb #10/A, model_4_unrelaxed.pdb #11/A
Associated model_4_unrelaxed.pdb chain A to best_model.pdb, chain A with 0
mismatches
Chains used in RMSD evaluation for alignment 2: best_model.pdb #1/A,
model_3_unrelaxed.pdb #5/A, model_4_unrelaxed.pdb #6/A, model_5_unrelaxed.pdb
#7/A, model_1_unrelaxed.pdb #8/A, model_2_unrelaxed.pdb #9/A,
model_3_unrelaxed.pdb #10/A, model_4_unrelaxed.pdb #11/A
> hide #11 models
> open
> C:/Users/mniak/Downloads/ChimeraX/AlphaFold/prediction_1/model_5_unrelaxed.pdb
Chain information for model_5_unrelaxed.pdb #12
---
Chain | Description
A | No description available
Associated model_5_unrelaxed.pdb chain A to best_model.pdb, chain A with 0
mismatches
Chains used in RMSD evaluation for alignment 1: best_model.pdb #1/A,
best_model.pdb #2/A, model_1_unrelaxed.pdb #3/A, model_2_unrelaxed.pdb #4/A,
model_3_unrelaxed.pdb #5/A, model_4_unrelaxed.pdb #6/A, model_5_unrelaxed.pdb
#7/A, model_1_unrelaxed.pdb #8/A, model_2_unrelaxed.pdb #9/A,
model_3_unrelaxed.pdb #10/A, model_4_unrelaxed.pdb #11/A,
model_5_unrelaxed.pdb #12/A
Associated model_5_unrelaxed.pdb chain A to best_model.pdb, chain A with 0
mismatches
Chains used in RMSD evaluation for alignment 2: best_model.pdb #1/A,
model_3_unrelaxed.pdb #5/A, model_4_unrelaxed.pdb #6/A, model_5_unrelaxed.pdb
#7/A, model_1_unrelaxed.pdb #8/A, model_2_unrelaxed.pdb #9/A,
model_3_unrelaxed.pdb #10/A, model_4_unrelaxed.pdb #11/A,
model_5_unrelaxed.pdb #12/A
> hide #12 models
> ui mousemode right "move picked models"
> view orient
> ~select #1
1 model selected
> ui tool show "Side View"
> open https://www.rbvi.ucsf.edu/chimerax/tutorials.html
Opened https://www.rbvi.ucsf.edu/chimerax/tutorials.html
> ui tool show "Build Structure"
> build start peptide "custom built" KKKKELGDAYVSSDEEF -57.0,-47.0 -57.0,-47.0
> -57.0,-47.0 -57.0,-47.0 -57.0,-47.0 -57.0,-47.0 -57.0,-47.0 -57.0,-47.0
> -57.0,-47.0 -57.0,-47.0 -57.0,-47.0 -57.0,-47.0 -57.0,-47.0 -57.0,-47.0
> -57.0,-47.0 -57.0,-47.0 -57.0,-47.0 rotLib Dunbrack
Chain information for custom built #13
---
Chain | Description
A | No description available
> build start peptide "custom built" KKKKELGDAYVSSDEEF -57.0,-47.0 -57.0,-47.0
> -57.0,-47.0 -57.0,-47.0 -57.0,-47.0 -57.0,-47.0 -57.0,-47.0 -57.0,-47.0
> -57.0,-47.0 -57.0,-47.0 -57.0,-47.0 -57.0,-47.0 -57.0,-47.0 -57.0,-47.0
> -57.0,-47.0 -57.0,-47.0 -57.0,-47.0 rotLib Dunbrack
Chain information for custom built #14
---
Chain | Description
A | No description available
> hide #14 models
> hide #!1 models
> hide #5 models
> build start peptide "custom built" KKKKELGDAYVSSDEEF -57.0,-47.0 -57.0,-47.0
> -57.0,-47.0 -57.0,-47.0 -57.0,-47.0 -57.0,-47.0 -57.0,-47.0 -57.0,-47.0
> -57.0,-47.0 -57.0,-47.0 -57.0,-47.0 -57.0,-47.0 -57.0,-47.0 -57.0,-47.0
> -57.0,-47.0 -57.0,-47.0 -57.0,-47.0 rotLib Dunbrack
Chain information for custom built #15
---
Chain | Description
A | No description available
> close #15
> close #14
> build start peptide "custom built" KKKKELGDAYVSSDEEF -57.0,-47.0 -57.0,-47.0
> -57.0,-47.0 -57.0,-47.0 -57.0,-47.0 -57.0,-47.0 -57.0,-47.0 -57.0,-47.0
> -57.0,-47.0 -57.0,-47.0 -57.0,-47.0 -57.0,-47.0 -57.0,-47.0 -57.0,-47.0
> -57.0,-47.0 -57.0,-47.0 -57.0,-47.0 rotLib Dunbrack
Chain information for custom built #14
---
Chain | Description
A | No description available
> build start peptide "custom built" KKKKELGDAYVSSDEEF -57.0,-47.0 -57.0,-47.0
> -57.0,-47.0 -57.0,-47.0 -57.0,-47.0 -57.0,-47.0 -57.0,-47.0 -57.0,-47.0
> -57.0,-47.0 -57.0,-47.0 -57.0,-47.0 -57.0,-47.0 -57.0,-47.0 -57.0,-47.0
> -57.0,-47.0 -57.0,-47.0 -57.0,-47.0 rotLib Dunbrack
Chain information for custom built #15
---
Chain | Description
A | No description available
You must select exactly one atom to modify.
> show #!1 models
> show #5 models
> hide #15 models
> hide #14 models
> hide #13 models
===== Log before crash end =====
Log:
UCSF ChimeraX version: 1.4.dev202202090150 (2022-02-09)
© 2016-2021 Regents of the University of California. All rights reserved.
How to cite UCSF ChimeraX
OpenGL version: 3.3.0 - Build 27.20.100.9365
OpenGL renderer: Intel(R) UHD Graphics
OpenGL vendor: Intel
Locale: pl_PL.cp1250
Qt version: PyQt5 5.15.2, Qt 5.15.2
Qt platform: windows
Manufacturer: Dell Inc.
Model: Inspiron 3593
OS: Microsoft Windows 10 Home (Build 19043)
Memory: 8,346,107,904
MaxProcessMemory: 137,438,953,344
CPU: 8 Intel(R) Core(TM) i5-1035G1 CPU @ 1.00GHz
OSLanguage: pl-PL
Installed Packages:
alabaster: 0.7.12
appdirs: 1.4.4
Babel: 2.9.1
backcall: 0.2.0
blockdiag: 3.0.0
certifi: 2021.10.8
cftime: 1.5.2
charset-normalizer: 2.0.11
ChimeraX-AddCharge: 1.2.3
ChimeraX-AddH: 2.1.11
ChimeraX-AlignmentAlgorithms: 2.0
ChimeraX-AlignmentHdrs: 3.2
ChimeraX-AlignmentMatrices: 2.0
ChimeraX-Alignments: 2.2.3
ChimeraX-AlphaFold: 1.0
ChimeraX-AltlocExplorer: 1.0.1
ChimeraX-AmberInfo: 1.0
ChimeraX-Arrays: 1.0
ChimeraX-Atomic: 1.36
ChimeraX-AtomicLibrary: 6.0.1
ChimeraX-AtomSearch: 2.0
ChimeraX-AtomSearchLibrary: 1.0
ChimeraX-AxesPlanes: 2.1
ChimeraX-BasicActions: 1.1
ChimeraX-BILD: 1.0
ChimeraX-BlastProtein: 2.0
ChimeraX-BondRot: 2.0
ChimeraX-BugReporter: 1.0
ChimeraX-BuildStructure: 2.6.1
ChimeraX-Bumps: 1.0
ChimeraX-BundleBuilder: 1.1
ChimeraX-ButtonPanel: 1.0
ChimeraX-CageBuilder: 1.0
ChimeraX-CellPack: 1.0
ChimeraX-Centroids: 1.2
ChimeraX-ChemGroup: 2.0
ChimeraX-Clashes: 2.2.2
ChimeraX-ColorActions: 1.0
ChimeraX-ColorGlobe: 1.0
ChimeraX-ColorKey: 1.5.1
ChimeraX-CommandLine: 1.2.1
ChimeraX-ConnectStructure: 2.0
ChimeraX-Contacts: 1.0
ChimeraX-Core: 1.4.dev202202090150
ChimeraX-CoreFormats: 1.1
ChimeraX-coulombic: 1.3.2
ChimeraX-Crosslinks: 1.0
ChimeraX-Crystal: 1.0
ChimeraX-CrystalContacts: 1.0
ChimeraX-DataFormats: 1.2.2
ChimeraX-Dicom: 1.0
ChimeraX-DistMonitor: 1.1.5
ChimeraX-Dssp: 2.0
ChimeraX-EMDB-SFF: 1.0
ChimeraX-ExperimentalCommands: 1.0
ChimeraX-FileHistory: 1.0
ChimeraX-FunctionKey: 1.0
ChimeraX-Geometry: 1.1
ChimeraX-gltf: 1.0
ChimeraX-Graphics: 1.1
ChimeraX-Hbonds: 2.1.2
ChimeraX-Help: 1.2
ChimeraX-HKCage: 1.3
ChimeraX-IHM: 1.1
ChimeraX-ImageFormats: 1.2
ChimeraX-IMOD: 1.0
ChimeraX-IO: 1.0.1
ChimeraX-ItemsInspection: 1.0
ChimeraX-Label: 1.1
ChimeraX-ListInfo: 1.1.1
ChimeraX-Log: 1.1.5
ChimeraX-LookingGlass: 1.1
ChimeraX-Maestro: 1.8.1
ChimeraX-Map: 1.1
ChimeraX-MapData: 2.0
ChimeraX-MapEraser: 1.0
ChimeraX-MapFilter: 2.0
ChimeraX-MapFit: 2.0
ChimeraX-MapSeries: 2.1
ChimeraX-Markers: 1.0
ChimeraX-Mask: 1.0
ChimeraX-MatchMaker: 2.0.6
ChimeraX-MDcrds: 2.6
ChimeraX-MedicalToolbar: 1.0.1
ChimeraX-Meeting: 1.0
ChimeraX-MLP: 1.1
ChimeraX-mmCIF: 2.7
ChimeraX-MMTF: 2.1
ChimeraX-Modeller: 1.5.1
ChimeraX-ModelPanel: 1.3.1
ChimeraX-ModelSeries: 1.0
ChimeraX-Mol2: 2.0
ChimeraX-Morph: 1.0
ChimeraX-MouseModes: 1.1
ChimeraX-Movie: 1.0
ChimeraX-Neuron: 1.0
ChimeraX-Nucleotides: 2.0.2
ChimeraX-OpenCommand: 1.8
ChimeraX-PDB: 2.6.6
ChimeraX-PDBBio: 1.0
ChimeraX-PDBLibrary: 1.0.2
ChimeraX-PDBMatrices: 1.0
ChimeraX-PickBlobs: 1.0
ChimeraX-Positions: 1.0
ChimeraX-PresetMgr: 1.1
ChimeraX-PubChem: 2.1
ChimeraX-ReadPbonds: 1.0.1
ChimeraX-Registration: 1.1
ChimeraX-RemoteControl: 1.0
ChimeraX-ResidueFit: 1.0
ChimeraX-RestServer: 1.1
ChimeraX-RNALayout: 1.0
ChimeraX-RotamerLibMgr: 2.0.1
ChimeraX-RotamerLibsDunbrack: 2.0
ChimeraX-RotamerLibsDynameomics: 2.0
ChimeraX-RotamerLibsRichardson: 2.0
ChimeraX-SaveCommand: 1.5
ChimeraX-SchemeMgr: 1.0
ChimeraX-SDF: 2.0
ChimeraX-Segger: 1.0
ChimeraX-Segment: 1.0
ChimeraX-SelInspector: 1.0
ChimeraX-SeqView: 2.4.6
ChimeraX-Shape: 1.0.1
ChimeraX-Shell: 1.0
ChimeraX-Shortcuts: 1.1
ChimeraX-ShowAttr: 1.0
ChimeraX-ShowSequences: 1.0
ChimeraX-SideView: 1.0
ChimeraX-Smiles: 2.1
ChimeraX-SmoothLines: 1.0
ChimeraX-SpaceNavigator: 1.0
ChimeraX-StdCommands: 1.7.7
ChimeraX-STL: 1.0
ChimeraX-Storm: 1.0
ChimeraX-StructMeasure: 1.0.1
ChimeraX-Struts: 1.0.1
ChimeraX-Surface: 1.0
ChimeraX-SwapAA: 2.0
ChimeraX-SwapRes: 2.1.1
ChimeraX-TapeMeasure: 1.0
ChimeraX-Test: 1.0
ChimeraX-Toolbar: 1.1
ChimeraX-ToolshedUtils: 1.2.1
ChimeraX-Tug: 1.0
ChimeraX-UI: 1.16
ChimeraX-uniprot: 2.2
ChimeraX-UnitCell: 1.0
ChimeraX-ViewDockX: 1.1
ChimeraX-VIPERdb: 1.0
ChimeraX-Vive: 1.1
ChimeraX-VolumeMenu: 1.0
ChimeraX-VTK: 1.0
ChimeraX-WavefrontOBJ: 1.0
ChimeraX-WebCam: 1.0
ChimeraX-WebServices: 1.0
ChimeraX-Zone: 1.0
colorama: 0.4.4
comtypes: 1.1.10
cxservices: 1.1
cycler: 0.11.0
Cython: 0.29.26
debugpy: 1.5.1
decorator: 5.1.1
docutils: 0.17.1
entrypoints: 0.4
filelock: 3.4.2
fonttools: 4.29.1
funcparserlib: 1.0.0a0
grako: 3.16.5
h5py: 3.6.0
html2text: 2020.1.16
idna: 3.3
ihm: 0.26
imagecodecs: 2021.11.20
imagesize: 1.3.0
ipykernel: 6.6.1
ipython: 7.31.1
ipython-genutils: 0.2.0
jedi: 0.18.1
Jinja2: 3.0.3
jupyter-client: 7.1.0
jupyter-core: 4.9.1
kiwisolver: 1.3.2
line-profiler: 3.4.0
lxml: 4.7.1
lz4: 3.1.10
MarkupSafe: 2.0.1
matplotlib: 3.5.1
matplotlib-inline: 0.1.3
msgpack: 1.0.3
nest-asyncio: 1.5.4
netCDF4: 1.5.8
networkx: 2.6.3
numexpr: 2.8.1
numpy: 1.22.1
openvr: 1.16.802
packaging: 21.3
ParmEd: 3.4.3
parso: 0.8.3
pickleshare: 0.7.5
Pillow: 9.0.0
pip: 21.3.1
pkginfo: 1.8.2
prompt-toolkit: 3.0.27
psutil: 5.9.0
pycollada: 0.7.2
pydicom: 2.2.2
Pygments: 2.11.2
PyOpenGL: 3.1.5
PyOpenGL-accelerate: 3.1.5
pyparsing: 3.0.7
PyQt5-commercial: 5.15.2
PyQt5-sip: 12.8.1
PyQtWebEngine-commercial: 5.15.2
python-dateutil: 2.8.2
pytz: 2021.3
pywin32: 303
pyzmq: 22.3.0
qtconsole: 5.2.2
QtPy: 2.0.1
RandomWords: 0.3.0
requests: 2.27.1
scipy: 1.7.3
setuptools: 59.8.0
sfftk-rw: 0.7.1
six: 1.16.0
snowballstemmer: 2.2.0
sortedcontainers: 2.4.0
Sphinx: 4.3.2
sphinx-autodoc-typehints: 1.15.2
sphinxcontrib-applehelp: 1.0.2
sphinxcontrib-blockdiag: 3.0.0
sphinxcontrib-devhelp: 1.0.2
sphinxcontrib-htmlhelp: 2.0.0
sphinxcontrib-jsmath: 1.0.1
sphinxcontrib-qthelp: 1.0.3
sphinxcontrib-serializinghtml: 1.1.5
suds-community: 1.0.0
tables: 3.7.0
tifffile: 2021.11.2
tinyarray: 1.2.4
tornado: 6.1
traitlets: 5.1.1
urllib3: 1.26.8
wcwidth: 0.2.5
webcolors: 1.11.1
wheel: 0.37.1
wheel-filename: 1.3.0
WMI: 1.5.1
Change History (1)
comment:1 by , 4 years ago
| Cc: | added |
|---|---|
| Component: | Unassigned → Graphics |
| Owner: | set to |
| Platform: | → all |
| Project: | → ChimeraX |
| Status: | new → assigned |
| Summary: | ChimeraX bug report submission → Crash drawing side view during alphafold prediction |
Note:
See TracTickets
for help on using tickets.